KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514854
Entry
107514854         CDS       T06036                                 

Gene name
ADAMTS13
Definition
(RefSeq) LOW QUALITY PROTEIN: A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Brite
KEGG Orthology (KO) [BR:ray00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ray01002]
    107514854 (ADAMTS13)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     107514854 (ADAMTS13)
Peptidases and inhibitors [BR:ray01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   107514854 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin Reprolysin_3 Reprolysin_4 Reprolysin_5 TSP1_spondin Reprolysin_2 Peptidase_M10 ADAM_spacer1 TSP1_CCN
Other DBs
NCBI-GeneID: 107514854
NCBI-ProteinID: XP_016008493
Position
Unknown
AA seq 1725 aa
MRTGQQDRSWNRRSVGCRRPERWCLRCRPLLARREPACCHGIPSESTAPEPWAAAPAFGP
GGLAQPHPRCRASWGALNARTSPGQRPGCSSRSLPAPPPHTHTQPLSWEGTPHRKQPAYW
PRPVGGDLSHSTPDLQSLWLSLGPLRMSELRPWGRCLWGILTSAFLLLSCRGLPDVQQRF
LQALEPEEVTSYFGPDATLGGTCPCLFQAREVSLHFISPWNQGPGILVALLGRGAGRRWT
PPQGAGRQARAPPHKFSPKGTASGPSPHEGQVGEGDVGVGADRLYVQPLRRPHRERAPHG
GSAQPHLVHRRAAAVPGDAHGRPSPRPPRHDAERSVLHLELLVAVGPDVHRAHEEDTERY
VLTNLNMGSELLRDPSLGAQFRVHLVKMIILTQPEDAPNITANITSSLLSVCEWSKTVNP
EDDTDPGHADLVLYITRFDLELPDGNRQVRGVTQLGGVCSSSWSCVITEDTGFDLGVTIA
HEIGHSFGLEHDGDPDGGCPARGHVMGADAAAPRGGPAWSACSRRQLSHLLSTGRARCVW
DPPGPRSRPAGRPPEAHPGLYYGADEQCRVAFGPGAVACTFAREDLDMCQALSCHTEPLD
QSSCSRLLVPLLDGTACGPEKWCFKGHCRSLAELTPMGAVHGHWSAWGPPSPCSRSCGGG
VVTRRRQCNNPRPAFGGRACVGADLQAVMCNTQACTKTQLEFMAEQCAQTDRKPLYLSPG
NASFYRWGAAVPYSRGDSLCRHMCWAVGESFIVRRGDSFLDGTRCVPSGPQEDGALSLCV
SGNCRTFGCDGRMDSQQVPDACQVCGGDNSSCSPQNGSFSGGRAGEYVTFLTLGPNLTGV
YIANHQPLFTHLAVRVRGRYVVAGNTSISPSTAHPSPLEDSRVQYTVTLAEGRLPRLEEL
RIRGPTQEDVEIQVYRRYGEEYGDLARPDVTFTYFQPKQRRAWAWAAVRGSCSASCGAGL
RWVTYSCLDQARSQRAEAALCGGGPRPEAWQEPCSPQPCPPHWAAGDFGPCSASCGGGLQ
ERAVRCVGARGAVLTTLPPARCAALAPRPAEVDTCNPQPCPTGWEASDACSSACAADLAT
QNVTCVQEAGGPEAPVTAGPCSTDKPPALEPCTETTCPPGGGHLDPQPPGEGTTSPLGSA
GPGARATHVWTPVAGPCSVSCGRGLMELRFVCVDSGLRTPAQEELCDVASKPRSRRGVCR
AAPCPARWETRALAPCPVTCGGGQVPLAVRCVRMDHGRAMPLPHSECWPAPRPGPREDCS
SEPCPARWRYKLAACSVSCGGGVVRRMPYCARARGEDEDEEVLPDAQCRGLPRPRPQEAC
GLEPCPPRWKVMSLGPCSASCGLGTATRSVACVRLHHGQDAAVDEAACAALVRPRASIPC
IVADCTYRWHVGTWTQCSVSCGDGIRHRRDTCLGPQAQGPMPADFCRHLPKPPTVQSCWA
GPCTGQATLSPAPPEEAPAPGQTTAASAGAAPEWPQPRAGRLSPAPGPQERVAESSACGR
QHLEPTGTIDMRGPGQADCVVAIGRPLGEVVTLQVLESSLNCSAGEMLLLWGRLTWRKTC
RKLSGTTFHSKANTLVVRQRRVRSGGGVLLRYSSRPAPGTFHRECDVQLFGPWGKIESPS
MSADGRGAAGCRLFIDVAPRARIAVHALATHTDAGPGGAEASYVLIRDIHSLRTTTFQRQ
QVIYWESEGSQAEMEFSQGFLQTHSLRGQYWTLHSGAQEPGRALP
NT seq 5178 nt   +upstreamnt  +downstreamnt
atgaggacaggacagcaagacaggtcgtggaaccgaaggagcgtgggctgccggaggcct
gaacgctggtgccttcggtgcagacccttgttagccaggagggagccagcctgctgccac
ggcatcccgagtgagtccacggctccagagccctgggccgctgctcccgcctttggacct
ggcggcttggcccagccccaccccaggtgcagggccagctggggtgccctgaacgctagg
accagcccagggcaaaggccaggttgcagcagcagaagcctgccggcgccccccccccac
acacacacacagcccctgtcctgggagggaactccccacaggaaacagccagcctactgg
ccccgcccagtcgggggggatctgtcacattccacaccagacttgcagtcactgtggctc
tccctgggcccgctgaggatgagcgagcttcgcccttgggggagatgcttgtggggaatt
ctcacttctgccttccttctcctcagctgccggggactcccagatgtccagcagcgattt
cttcaggctttggagcccgaggaagtgacttcctactttggccctgatgctaccttggga
ggtacttgtccttgcctcttccaggcaagggaggtttctctgcatttcatctcaccatgg
aatcaggggcctgggattttggtggctctgctgggacgaggagccggaaggagatggacg
ccaccccagggtgctgggcgccaggcccgggctcctccccacaaattctcaccgaaggga
acagcttccggcccctccccacacgaaggccaagtcggggagggcgacgtcggggtgggt
gccgacaggctctacgtccagccgctgaggaggccgcaccgggaacgggcgcctcacggg
ggcagcgcccagccccacctggtccacaggcgtgccgccgcggtcccgggggacgctcac
ggccggccttcacctcgccccccgaggcacgacgctgagaggagtgtcctgcacctggag
ctgctggtggccgtgggccccgatgtccaccgggctcacgaggaggacacggagcgctac
gtgctcaccaacctcaacatggggtcagagctgctgcgggacccgtccctgggggctcag
ttccgagtgcacctggtgaagatgatcatcctgacacagcccgaggatgctccaaacatc
acggccaacatcacctcgtcgctgctgagcgtctgtgagtggagcaagacagtcaacccc
gaggacgacacggaccccgggcacgccgacctggtcctctacatcaccaggtttgacctg
gagctgcctgacggtaaccggcaggttcggggggtcacccagctggggggtgtctgctcc
tcctcctggagctgtgtcatcactgaagatactggcttcgacctgggggtcaccatcgcc
catgagattgggcacagcttcggcctggagcacgacggtgacccggacggcggctgcccg
gcccgcggccacgtgatgggcgccgacgcggccgccccgcgcgggggccctgcgtggtcc
gcctgcagccgccggcagctgtcgcacctgctcagcacaggacgggcgcgctgcgtgtgg
gacccgccggggccgcggtccaggcccgcggggcgccctcctgaggcgcacccaggcctc
tactacggcgcggatgagcagtgccgcgtggcctttggccctggggcggtcgcctgcacc
ttcgccagggaggacctcgacatgtgccaggctctgtcctgccacacggagcccctggac
caaagcagctgcagccgcctcctcgttcctctgctggacgggacagcgtgtggcccggag
aagtggtgcttcaagggtcactgccgctccctggcggagctgacccccatgggggcagtg
cacgggcactggtccgcttggggtccccccagtccttgctcccgctcctgcggaggaggc
gtggtcaccaggaggcggcagtgcaacaacccgagacctgcctttggggggcgcgcgtgc
gtaggtgccgacctccaggccgtgatgtgcaacacccaggcctgcacgaagacccagctg
gagttcatggcggagcagtgcgcgcagaccgacaggaagcccctgtacctgtccccaggc
aacgcctccttctaccgctggggcgctgccgtgccgtacagtcgaggggactctctgtgc
agacacatgtgctgggccgttggtgagagcttcatcgtgaggcgtggggacagcttccta
gacgggacccggtgtgtgccgagtggccctcaggaggacggggccctgagcctgtgcgtg
tcgggcaactgcaggacgttcggctgtgacggcaggatggactcgcagcaggtgccagac
gcgtgccaggtgtgcggaggggacaacagctcgtgcagcccgcagaacggctctttctca
ggcgggagagccggagagtacgtcacgttcctgacgctcggccccaacctgactggtgtc
tacatcgccaaccaccagcctctgttcacgcacctggcagtgcgggtccgagggcgctac
gtcgtggccgggaacacgagcatctctcccagcaccgcccacccctccccgctggaggac
agccgagtccagtacacagtgactctcgcggagggccggctgcctcgcctggaggagctc
cgcatccggggacccacccaggaggacgtggagatccaggtttacaggcgctatggcgag
gagtatggcgacctcgcccggccagacgtcaccttcacctacttccagccgaagcagcgg
cgggcctgggcgtgggccgccgtgcggggctcctgctcagcgagctgtggggcagggctg
cgctgggtgacctacagctgtctggaccaggccaggagccagcgggcggaggccgccctg
tgcggagggggcccgaggccggaggcgtggcaggagccctgcagcccccagccctgcccc
ccacactgggcagctggagacttcggcccgtgcagcgcctcctgtgggggcggcctgcag
gagcgggcggtgcgctgcgtgggggcccggggcgccgtcctgacgacgctgccccccgcc
cggtgtgcggcgctggccccgcggccggctgaggtggacacctgcaacccccagccctgc
cccacagggtgggaggcgtcggacgcctgctcgtcggcctgtgcagcagacctggccaca
cagaatgtgacgtgtgtgcaggaggcgggcggcccggaggcaccagtgacagctgggccc
tgctccacggacaagccacctgccctcgagccctgtacggagaccacttgtcctccaggc
gggggccacctggacccccagcctccaggagaggggactacgtccccattgggcagtgcc
gggccgggggctcgagctacacacgtgtggacccctgtggcagggccgtgctccgtctcc
tgtggtcgaggcctgatggagctgcgtttcgtgtgcgtggactctggcctccggacgccg
gcccaggaagagctgtgcgacgtggcgagcaagcccagaagccggcggggggtgtgccgg
gccgccccgtgcccggctcggtgggagacgcgagccttggccccgtgcccagtgacctgt
ggcggggggcaggtgccgctggccgtgcgctgtgtgaggatggaccacggacgcgccatg
cccctgccccactccgagtgctggccggcgccccgccccggcccccgcgaggactgcagc
tcggagccctgccccgccaggtggcggtacaagctggcggcctgcagcgtgagctgtggg
ggaggcgtcgtgcggaggatgccgtactgtgcccgggctcgcggggaggacgaggacgag
gaggtcctgccggacgcccagtgccgcgggctgcctcgcccgaggccgcaggaggcctgt
ggcctggagccctgcccacccaggtggaaagtcatgtcccttggcccatgctcagccagc
tgtgggctcggcacggccacgcgctcggtcgcctgcgtgcggctccaccacggccaggac
gcagcggtggacgaggccgcctgtgcggctctggtgcgcccgcgggccagcatcccctgc
atcgttgctgactgcacctaccggtggcatgtcggcacctggacgcagtgctccgtctcc
tgtggggatggcatccggcaccggcgtgacacctgccttggaccccaggcccagggcccc
atgccagctgacttctgccggcacttgcccaagccgccgacggtgcagagctgctgggct
gggccctgtacggggcaggcgacactcagcccggcgccccctgaggaagctcctgcccca
ggccagaccacagctgccagcgctggtgctgccccggagtggccccagccccgggctggc
cgcctctccccagctccagggccccaggagagggtggcagagtccagtgcctgcggccgg
cagcacctggagccgacaggaaccattgacatgcgaggcccagggcaggctgactgtgtg
gtggctatcgggcggccgctgggcgaggtggtgaccctccaagtcctcgagagttccctc
aactgcagcgctggagagatgctgctgctttggggcaggctcacgtggaggaagacgtgc
aggaagctgtccggcacgaccttccactccaaagccaacacgctggtggtgaggcagcgc
cgtgtgcggtcaggaggcggagttttgctgcggtactccagccggccagcccccggaacc
tttcacagagaatgtgacgtgcagctctttggaccctggggtaaaatcgaaagcccctcg
atgagtgcagacgggaggggcgcggcgggctgccgcctcttcattgacgtggctccgcgg
gcccgcatcgccgtccacgccctggccactcacacggacgctggccctgggggggccgaa
gccagctacgtcctgatccgagacatccacagcctgaggacgacgacattccaaaggcag
caagtgatctactgggagtcagagggcagccaggctgagatggagttcagccagggtttc
ctgcaaacgcacagcctgcgcggccagtactggaccctgcactctggagcgcaggagccc
gggagggccctgccctag

DBGET integrated database retrieval system