KEGG   Rousettus aegyptiacus (Egyptian rousette): 107517003
Entry
107517003         CDS       T06036                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3 isoform X1
  KO
K15195  AF4/FMR2 family member 3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Brite
KEGG Orthology (KO) [BR:ray00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ray03021]
    107517003 (AFF3)
Transcription machinery [BR:ray03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     107517003 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 107517003
NCBI-ProteinID: XP_016012721
Position
Unknown
AA seq 1291 aa
MDSFDLALLQEWDLESLWGEDILNQRNESLVLEFQSSASRCRSVYEPDRNVLRRKERERR
NQETQQDDGTFNSSYSLFSEPYKTNKGDELSNRIQNTLGNYDEMKDFLTDRSNQSHLVGV
PKPGLPQAAMNKLDEHFVADSRAQPQPSSVCSTAPSTPAAVPVLQSKRGTMGWQKAGHPP
PDGQQRASKRGHNLIDLNRSAHPKNFSKTPDRCTSSPLSSPSSSSSSHSAQQGSLRTLLG
DGVGRQQPRAKQVCNIEVGLQTQERPPAMAAKHSGSGHCVQNFPPSLASKPSLGQQKPTA
YVRPMDGQDQAPDQSPKLKSSTEASVHCTSYRGVPATKPESTRAKGKLPKFSVPKQAEES
RSGETNSCVEEIIREMTWLPPLSAIQAPGKVESSKFSFPNKDSQLISSGHSNPKKSDTET
ESPDNGTSNTSMLEDDLKLSSDEEENEQQAAQRTTLHALSDSAVVQQANCRASVPSSKGS
SSGSSSSGSSSSSDSESSSGSDSDTESSSSESEGSKPAHYPSPEAEPASSNKWQLDKWLN
KVNPHKPPILIQNESHGPEGSQYYAPGKDQVQDCTKLPDGCQAGLREKDIKSACKEEQRP
RTANKAPGAKGVKQKSPPAAVAVAVTTAAPPPAVPGAPPDNTTARRSTGKKPPRRTERTL
ASDSANCHRPEEPTDTLGTGAVIPPEPTKAKPCSNSRTGHRKELRASASVTCEKRRTRGL
SRIIPKSKEFIETESSSSSSSSDSDLESEQEVYPPAKAQAVAAAASTSDQRLKEAAASIS
GGGGPRAPVGSINARTTSDIAKELEEQFYTLVPFGRNELLSPLKDNDEIRSLWVKIDLTL
LSRIPEHLPQEPGILSAPATKDAESVPPSHPSDTPAEKALPKSKRKRKCDNEDDYREMKK
AQGEKDSSSRPTTSASNALSANHSSMAINSLAVPINKNEKMLRSPVSPLSDASKHKHSNE
DLTSSSRSNGGGLFTSAPSNKKHKAENQLQPHSGELTKTVHNNSENAVHKSRPQTEPWSP
GSNSHRDCKRQRLVFDDMPRSADYFMQEAKRMKHKADAMVEKFGKALNYAEAALSFIECG
NAMEQGPMESKSPYTMYSETVELIRYAMRLKTHSGPNATPEDKQLAALCYRCLALLYWRM
FRLKRDHAVKYSKALIDYFKNSSKAAQAPSPWGASGKSTGTSSPMSPSPSPTSSVGSQGG
LPHANALSPSTIVSIPQRIHQMAANHVSITNSILHSYDYWEMADNLAKENREFFNDLDLL
MGPVTLHSSMEHLVQYSQQGLHWLRNSTHLS
NT seq 3876 nt   +upstreamnt  +downstreamnt
atggacagcttcgacttagccctgctccaggaatgggacctcgagtcgctgtggggtgaa
gacatcttaaaccagaggaatgaatctctagtgctggagttccagtcgtcagccagccga
tgtaggagtgtctatgaaccagatagaaacgtgttacggaggaaagaacgagaaagaaga
aatcaggaaactcaacaggatgatggcacatttaattccagttactcccttttcagtgaa
ccctacaagactaacaagggggatgagctctccaaccggatccagaacactttaggcaat
tacgatgaaatgaaagactttttaactgatagatctaatcagagtcatctcgttggcgtt
cccaaaccggggctccctcaggctgctatgaacaagcttgatgagcattttgttgcagat
tcacgagcccaaccccagccctcatctgtctgcagcactgcaccctccacaccagcagct
gtccctgtgctgcagagtaagaggggcaccatgggctggcagaaggctgggcatccgcct
cccgacggccagcagagagcaagtaagcgcggacacaacttgattgatttgaacagatct
gctcaccctaagaactttagcaaaacacctgatcgctgtacgtcgagccctttgtcctca
ccttcctcctcttcttcttcccactcagcacagcagggctctctcaggaccttgctcggc
gatggtgttggcagacagcaaccacgggccaaacaagtgtgcaacatagaggtgggtctt
cagacccaggaaaggccccctgcaatggcagccaagcacagcggcagtggacactgtgtt
cagaactttcctccgtctctggcttcaaaacccagcctaggccagcagaagccgaccgca
tacgtgcggccgatggatggccaggatcaggctcctgatcagtctccgaaacttaagtca
tccacagaagccagcgtgcactgcacgtcgtacaggggggtcccagccaccaagccagag
tccaccagagccaagggcaagcttcccaagttcagcgtccccaaacaggcggaggagagt
agatctggagaaactaacagctgtgtggaagagatcatccgggagatgacctggcttcca
ccactttctgctattcaagcacctggcaaagtggaatccagcaaattttcatttccaaat
aaggactctcagctcatttcctctggacacagtaatccaaagaaaagtgatactgagacg
gagagtccagacaatggcacctcaaatacatcaatgctagaagatgaccttaagctaagt
agtgatgaagaggaaaatgaacagcaggcagcgcagagaaccactctccacgctctgtct
gacagcgccgtggtccagcaggccaactgcagagcctcggtgccttccagcaagggcagc
agcagcggcagcagcagcagcggcagcagttcatccagtgactcggagagcagctccgga
tccgactcggacaccgagagcagctctagcgagagtgagggcagcaagcctgcccactac
cccagccccgaggctgagccagcatcctctaacaagtggcagctggataaatggctgaac
aaagttaatccccacaagccacctattctgatccaaaatgagagccatgggccagagggc
agccagtactacgccccggggaaagaccaagtgcaggactgcacgaagctcccagacggg
tgccaggccggcttgagagagaaggacatcaagagtgcttgcaaggaggagcagaggcca
aggacagcaaacaaggcgccaggggccaagggggtgaagcagaagtccccacccgcggct
gtggcagtggctgtgaccacagccgccccaccacccgcagtccctggcgcaccccccgac
aatacgactgctcgcaggtctacgggcaaaaagccgcctaggcgcacggagaggacttta
gccagcgacagcgccaactgccaccggcctgaggaacccacggacaccctggggacaggc
gcagtgatccccccagagcccaccaaagccaagccctgcagcaacagcagaacgggccac
cgcaaggagctgcgggcctctgcctctgtcacctgcgagaagcgccgcacacgggggctg
agcaggatcattcccaagtccaaggagttcatcgagacagagtcgtcatcttcgtcctcc
tcctcggactcagacctggagtcagagcaggaggtgtaccctccggccaaagcacaggcg
gtggctgctgctgcctccacaagtgaccagaggctcaaggaggctgctgccagtatcagc
ggaggcggtggcccccgcgcaccggtgggctccatcaacgccaggaccaccagtgacatt
gccaaggagctggaggaacagttctacactctggtccccttcggccgcaatgaactactc
tccccactgaaggacaatgatgagatcaggtccctatgggtcaaaatcgacctgaccctc
ctgtccaggatcccagaacacctgccccaggagccggggatcttgagtgctcctgcaacc
aaggacgctgagagtgtacctcccagccatccatccgacacacctgctgaaaaggctttg
ccaaaatccaagaggaaacgcaagtgtgacaatgaagatgactacagggagatgaagaag
gcccagggggagaaggacagctcatcacgaccaaccacctctgccagtaacgctttgtct
gcgaaccattccagcatggccatcaacagcttggcagtacccataaataaaaatgaaaaa
atgctccggtcgccagtctcacccctctctgatgcctctaaacacaaacactccaacgag
gacctgacgtcttccagcaggtccaatggcggtggtttgttcacttccgccccctccaac
aaaaagcacaaggccgagaaccagctgcagcctcacagcggagaactcacgaaaacggtt
cacaacaattcggaaaatgctgtccataagtcacggccacagacagagccatggtctcct
ggctccaacagccaccgggactgcaagaggcagagacttgtcttcgacgatatgccgcgt
agtgcagattattttatgcaagaagccaaacggatgaagcataaagcagatgcaatggtg
gaaaagtttgggaaggctttgaattatgccgaagcggccttgtcattcatcgagtgtgga
aatgcgatggagcagggcccgatggaatccaaatccccttacacgatgtactcggaaacg
gtggagctcatcaggtatgccatgagactaaaaacccactcaggccccaatgccacacca
gaggataaacagctggctgcgttgtgttaccgatgcctcgctcttctttactggcggatg
tttcgactcaaaagggatcatgctgtgaagtattcgaaagcacttatcgactatttcaag
aattcctcaaaagcagcccaagccccatctccatggggggccagtggaaagagcacaggg
acctcatcccccatgtctcccagcccatcccccaccagctccgtgggatctcaggggggc
ctcccccatgccaatgccttgtccccttcgaccatcgtcagcatcccacagcgcatccac
cagatggctgccaatcacgtcagcatcaccaacagcattctccacagctatgactactgg
gagatggcggacaacctggccaaggagaacagagaattcttcaatgacctggatcttctc
atggggcctgtcacgctgcacagcagcatggagcacctggtccagtactcccagcaaggc
ctgcactggctgaggaacagcacccacctgtcatag

DBGET integrated database retrieval system