KEGG   Rousettus aegyptiacus (Egyptian rousette): 107518273
Entry
107518273         CDS       T06036                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Brite
KEGG Orthology (KO) [BR:ray00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ray01002]
    107518273 (ERAP1)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     107518273 (ERAP1)
Peptidases and inhibitors [BR:ray01002]
 Metallo peptidases
  Family M1
   107518273 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 107518273
NCBI-ProteinID: XP_016015258
Position
Unknown
AA seq 942 aa
MKFLPVKWPLGTMSYLLSSLLIFLTASTSSWCQGSETTSPKASNGTPFPWNKMRLPEHII
PVHYNLMIHANLTTLTFEGTTAVEITVSQPTSAIILHSHHLQISKATLKNGAGERQSEEP
LRVLEYPPHEQIALLAPEPLAVGLPYTVVIDYAGNLSESFHGFYKSTYRTKEGEVRILAS
TQFEPTAARMAFPCFDEPAFKASFLVKIRREPRHLAISNMPLVKSVIIAEGLIEDHFDVT
VKMSTYLVAFIISDFKSVSKMTKSGVKVSVYAVPDKINQADYALDAAVTLLEFYEDYFSI
PYPLPKQDLAAIPDFQSGAMENWGLTTYRETSLLFDAEKSSASSKLGITMTVSHELAHQW
FGNLVTMEWWNDLWLNEGFAKFMEFVSVSVTHPELKVGDYFFGKCFNAMEVDALNSSHPV
STPVENPAQIREMFDDVSYEKGACILNMLRDYLGAEAFKNGIIQYLQKYSYKNTKNEDLW
NSMASICPTDSTQRMDGFCSGSHRSSLSSHWQQEGLDVKTMMNTWTLQKGFPLITITVRG
RNVHMKQEHYMKGANDITETGYLWHVPLTFITSKSDSAHKFLLKTKTDVLILPEEVEWIK
FNVGMNGYYIVHYEDDGWDSLTGLLKETHTSVSSNDRASLINNAFQLVSIGKLPIEKALD
LTLYLKHETEIMPVFQGLDELIPMYKLMEKRDMNEVETQFKAFLIRLLRNLIDKQTWTDN
GSVSERMLRSQLLLLACVRKYQPCVQRAEGYFREWKETNGNLRLPSDVTLAVFAVGAQTS
EGWDFLYKKYQSSLSDTEKNQIEFALCTSQNKEKLQWLLDQSLKGDIIKTQEFPDILRSI
GRNPVGYPLAWQFLRENWNKLVEKFELGSSSIAYMVMGTTNQFSTRARLEEVKGFFSSLK
ENGSQLRCVQQTIETIEENIRWMDKNFDKIRLWLQNQEPELL
NT seq 2829 nt   +upstreamnt  +downstreamnt
atgaaatttctacccgtgaaatggccacttggaaccatgtcatatctgctctcttcactg
ttaattttcttaactgcgtcaacttcttcctggtgtcagggtagtgaaactacatctcca
aaggctagtaatggaacaccatttccttggaataaaatgcgacttcctgagcacatcatc
ccggttcattataatctcatgatccacgcaaatctcaccactctgacttttgagggaact
acagcagtagaaatcacagtcagccagcccaccagtgccatcatcttgcatagtcaccac
ctgcaaatatctaaggccaccctcaagaatggagctggagagaggcagtctgaagagcca
ctgagagtcctggaatacccacctcacgagcagatcgcacttctggctccggagcctctg
gctgttgggctcccatacacagttgtcattgactatgctggcaatctctctgagagtttt
catggattttataaaagcacctacagaaccaaggaaggggaagtgaggatacttgcatca
acacagtttgaacctactgcagccagaatggcctttccctgctttgatgaacctgccttc
aaagcaagttttttagtcaagatcagaagggagccaaggcacctcgccatctccaatatg
ccgttggttaaatctgtgattattgctgaaggactcatagaagaccattttgatgtcact
gtgaagatgagcacctacctggtggccttcataatttcagattttaagtctgtcagcaag
atgaccaagagcggagtcaaggtttctgtgtacgctgtgccagacaagataaaccaggca
gattatgcactggatgctgcagtgactcttctagaattttacgaggattattttagcatt
ccgtatcccttacccaaacaagatcttgctgctattcctgactttcagtctggtgctatg
gaaaactggggactgacaacctatagggaaacttcactattgtttgatgctgaaaagtct
tctgcatccagtaagcttggcatcacaatgactgtgtctcatgaactcgcccaccagtgg
tttgggaatctggtcaccatggaatggtggaatgatctttggctaaatgagggatttgcc
aagtttatggagttcgtatctgtcagtgtgactcatccagaactgaaagttggagattat
ttctttggcaagtgttttaatgcaatggaagtagatgcattgaattcctcacaccctgtg
tccacacctgtagagaatcctgctcagattcgggagatgtttgatgatgtttcttatgaa
aagggagcttgtattttgaatatgctaagggattatcttggcgctgaggcatttaaaaac
ggtatcatacagtatctccagaagtatagctataaaaacacaaaaaacgaggacctgtgg
aatagtatggcaagtatttgccctacagatagcacacagaggatggatggcttttgctct
ggaagtcatcgttcatccttgtcttcacactggcagcaggaaggccttgatgtgaagacc
atgatgaacacctggacgctgcagaagggctttcccctgataaccatcacagtgagaggg
aggaatgtacacatgaagcaagagcactatatgaaaggagccaatgacattacagaaact
gggtatctgtggcatgttccattgacgttcatcaccagcaaatcagactccgcccacaaa
tttttgctgaagacaaaaacagatgtgctcatcctcccagaagaggtggaatggatcaaa
tttaatgtaggaatgaatggctattacattgtgcattatgaggatgatggatgggattct
ttgactggccttttaaaagaaacacacacatcagtcagcagtaatgatcgagccagtctc
attaacaatgcatttcagcttgtcagcattggaaagctaccgattgaaaaagccttggat
ttaaccttgtacttgaaacatgaaactgaaattatgcctgtgttccaaggtttggatgag
ctgatacctatgtataagttaatggagaaaagagatatgaatgaagtggaaactcaattc
aaggcctttctcatcaggctgctgaggaacctcattgataaacagacttggactgacaat
ggctcagtctcagagagaatgctgcggagtcagctcctcctcctcgcctgtgtgcgcaag
tatcagccctgcgtgcagagggcagaaggctatttcagagagtggaaggaaaccaatgga
aatctgagactgcccagtgatgtgaccttggcagtgtttgccgtgggggcccagacctct
gaaggatgggattttctttataagaaatatcagtcttctttgtccgatactgagaaaaac
caaattgaatttgccctctgtactagccaaaataaggaaaagcttcagtggctactagac
caaagtcttaagggagatataataaagactcaagagtttccagatattcttagatctatt
ggtagaaacccggtgggatatccactggcctggcagtttctgagggaaaactggaataaa
cttgtagaaaagtttgaacttggctcatcttccatagcctacatggtaatgggaacaaca
aatcaattctccacaagagcacggctcgaagaggtaaaaggattcttcagctctttgaaa
gaaaatggttctcagctccgttgtgtccaacagacaattgaaaccattgaggaaaacata
cgttggatggataagaattttgataaaatcagactgtggctccaaaatcaagagcctgaa
ctgctgtaa

DBGET integrated database retrieval system