KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519871Help
Entry
107519871         CDS       T06036                                 

Gene name
THNSL2
Definition
(RefSeq) threonine synthase-like 2
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Brite
KEGG Orthology (KO) [BR:ray00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107519871 (THNSL2)
Enzymes [BR:ray01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     107519871 (THNSL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 107519871
NCBI-ProteinID: XP_016018482
Position
Unknown
AA seq 484 aa AA seqDB search
MWYISTRGMAPRVDFEGALFSGYAPDGGLFMPEELPQLSRETLRQWSALSYPSLVKELCA
LFIGPELIPRDDLNDLIHQAFRRFRHNEVVHLSRLKNGLNVLELWHGVTYAFKDLSLCCT
AQFLQYFLEKREKHITVVVGTSGDTGSAAIESVQGAKNVDIIVLLPKGHCTKIQELQMTT
VLKENVHVFGVEGNSDELDEPIKAVFADVAFVKKHNLMSLNSINWSRILVQMAHHFFAYF
RCVPSLDMDPLPPVEVVVPTGAAGNLAAGCLAQKMGLPIRLVAAVNHNDIIHRTVQRGDF
SLSKTVKPTLASAMDIQVPYNMERIFWLFSGSDSQVTRALMEQFERTQSVRLPEELQSKL
SAAVTSESVSDEAITQAMGRCWKENQYLLCPHSAVAVSYHYQQMDRQQPSPPQCCLAPAS
AAKFPEAVLAAGLTPQIPSEVSALEKKETRCTPMQKSDDWTLMLRDTIEDIGQQWRGHFP
NAPE
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtggtacatcagcacccgggggatggctccgcgggtcgactttgagggggccctcttc
tctggctatgctcctgatgggggcctcttcatgcctgaggagctcccacagctgagcaga
gagacgctgcgtcagtggagtgcactctcctacccgagcctggtgaaggagctgtgtgcc
ctcttcatcggccctgagctcattccgagagatgacttaaatgatctgatccaccaagcc
ttccgcagattccgccataatgaggtggtccatctgtccaggctgaagaacgggctgaac
gtgttggagctgtggcatggggtcacgtatgcgtttaaggatctgtccctgtgctgcaca
gcacagttcttgcagtacttcctggagaagagggagaagcacatcactgtggttgtggga
acttcaggggacacaggaagtgctgccattgagagtgttcaaggggcaaagaatgtggac
atcattgttctgctgcccaagggtcactgcacgaagattcaggagctccagatgacaacg
gtgctgaaggagaatgtccatgtgtttggtgtggagggaaacagcgatgagctcgatgag
ccaatcaaggccgtgtttgcagatgtggcttttgtcaagaagcacaatctgatgagtctg
aattcaatcaactggtcccggatcctcgtgcaaatggcccaccacttctttgcttatttt
cggtgtgttccatccttagatatggacccactgccccctgtggaggtggttgtgccaacg
ggggctgctggtaaccttgcagctgggtgccttgctcagaagatgggcctgcccatccgc
ctggtcgcagcagtgaaccacaacgacatcatccataggactgtccagcgaggagacttc
tctctgtctaaaactgtcaaaccaaccttggcatcagctatggacattcaggtaccctac
aacatggagaggattttctggctgttttctggctctgacagccaggtgacaagagccctc
atggagcagtttgaaaggacccaaagtgtgaggctacctgaggaactgcaaagcaagctt
tcagcagcagtgacgtctgagtcggtgtcagatgaggccatcacccaggccatgggccgc
tgctggaaagagaaccagtacctgctgtgccctcactcagctgtggccgtgagctaccat
taccagcagatggacaggcagcagcccagcccaccccagtgttgcctggctcccgcctct
gcagccaagttcccagaagctgtcctcgctgctgggctgaccccacagattccctcggag
gtctcagccttggagaagaaagagacacgctgtaccccaatgcagaagagtgatgactgg
accctgatgcttcgggacacaattgaggacatagggcaacagtggaggggtcacttccct
aatgctccggaatag

DBGET integrated database retrieval system