KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521261
Entry
107521261         CDS       T06036                                 

Gene name
RDH5
Definition
(RefSeq) 11-cis retinol dehydrogenase isoform X1
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    107521261 (RDH5)
Enzymes [BR:ray01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     107521261 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 Mlo
Other DBs
NCBI-GeneID: 107521261
NCBI-ProteinID: XP_016021288
Position
Unknown
AA seq 293 aa
MGPACQVYATPWLQLAGSSFSGSSSQPSPTPAHTHLIALATSPPAACRLPTLALATARMG
AWKDWEQSLKQAKEVSGIVPPSFLQRSMWVLRDKQSLPPSDAFIFITGCDSGFRWFLALR
LGQRGFRVLASCLTPSGAENLQQVASPRLHTTPLDVTDLQSVQQATKWVETHVGETGLFC
LVNNAGVAGILGPTQWLARNDFHEVLNVNTRGPISVTLALLPLLQQARGRVVNITSILGR
LAAIGGGCCVSKFALEAFSDTLRWDVAPFGVQVSIIEPGFVSIIEPGFFQTPA
NT seq 882 nt   +upstreamnt  +downstreamnt
atgggtcctgcatgccaggtctatgccactccctggcttcagctggcaggctccagcttt
tctggctcctcctcccagccctcccccactccagctcacacacacttaatagctctggca
accagtcccccggctgcctgccggctgccgacgttggccttagctacagctcgaatggga
gcctggaaagactgggagcagtctctcaaacaagcaaaagaagtgtccggtattgtacct
cccagctttctccagaggagcatgtgggtgctcagagacaagcagagcctgcccccaagc
gatgccttcatcttcatcaccggttgtgactcgggcttcaggtggtttctggcactgaga
ctgggtcagagaggcttccgcgttttggccagctgcctgaccccatcaggggcagagaac
ctacagcaggtagcctccccccgactccataccaccccactggatgtcactgatctccag
agtgtccagcaggcaactaagtgggtagaaacacatgttggggaaacagggcttttttgt
ctggtgaataatgctggtgtggctggtatacttgggcccacacagtggctggcccgaaat
gacttccatgaggtgctgaatgtgaacacacgaggccccatcagtgtcacccttgccctg
ctacccctactgcaacaggcccggggccgcgtggtgaacatcaccagcatcctgggtcgc
ctggcagccattggtgggggctgctgtgtctccaagtttgccctggaggccttctcagac
accctgaggtgggatgtcgctccttttggggtacaagtctccatcatagaacctggcttc
gtctccatcatagaacctggcttcttccaaacccctgcataa

DBGET integrated database retrieval system