KEGG   Rhodopirellula baltica: RB2373Help
Entry
RB2373            CDS       T00134                                 

Gene name
fdh
Definition
(RefSeq) formaldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
rba  Rhodopirellula baltica
Pathway
rba00625  Chloroalkane and chloroalkene degradation
rba00680  Methane metabolism
rba01100  Metabolic pathways
rba01120  Microbial metabolism in diverse environments
rba01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    RB2373 (fdh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RB2373 (fdh)
Enzymes [BR:rba01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     RB2373 (fdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C PALP FAD_binding_2 2-Hacid_dh_C ADH_N_assoc Pyr_redox_3 XdhC_C
Motif
Other DBs
NCBI-GeneID: 1796367
NCBI-ProteinID: NP_864907
UniProt: Q7UVY0
Position
complement(1230126..1231334)
Genome map
AA seq 402 aa AA seqDB search
MSDNKGVVYLGAGKVDVQSIDDPKLELSYRGKTRQCHHGVILKVISTNICGSDQHMVRGR
TTAPAGMVLGHEITGEVIEVGRDVEFIKKGDICSVPFNIACGRCRCCKEGDTGVCENVNP
DRPGAAYGYVDMGGWIGGQSRYVMVPYADWNLLAFPDRDQALAKIRDLTMLSDIFPTGYH
GAYTAGVTTGSTVYVAGAGPVGLACAHAAQLLGAAVVIVGDMVEERLAQARSFGCETVDL
KTDASLPDMIEQILGSREVDCAVDCVGFEARGHGGDSGVEKPATVLNQVMEVTRVGGGVG
IPGLYVTDDPGGVDEAARTGNLSLRIGLGWAKSLHFTTGQCPVMKYNRGLMMAILHDRCQ
IAKAVNATVISLDDAPQGYADFDQGAAKKFVLDPHGVLAAST
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacaacaaaggtgttgtgtatctgggtgccggaaaggtcgatgttcaatcgatc
gacgatcccaaactggaactcagctaccgaggcaaaactcggcagtgccaccacggagtg
atcttgaaggtcatctccacaaacatttgcggatccgaccaacacatggttcgcggacgc
acaaccgccccggccggcatggtgctcgggcacgagatcacgggcgaagtcattgaggtc
ggccgtgacgttgaattcatcaagaagggtgacatctgcagcgtcccgttcaacatcgct
tgcggtcgatgccgttgctgcaaagaaggcgacaccggagtttgtgaaaacgtgaaccct
gatcgccccggcgcagcgtatggctacgtcgacatgggcggctggatcggcggccaatca
cgatacgtcatggttccctatgcggattggaatttgctggcgtttcccgaccgtgatcaa
gctctcgcgaaaattcgcgacttgaccatgttgtcggacattttcccgaccggttaccac
ggtgcatacaccgcgggggtgaccaccggcagcaccgtgtatgtcgcaggagccggcccg
gtgggtcttgcttgtgctcacgcggcccagttgcttggagcagcggttgtgatcgttgga
gacatggtggaagaacgactcgcacaggcacgctcgtttggttgcgaaacggttgacctc
aaaaccgatgcctcgctgcctgacatgatcgaacagatcctgggttcccgagaagtcgat
tgtgccgtcgactgcgttggattcgaagcccgcggccacggtggtgattcaggcgtcgaa
aaacccgccacggtgctcaaccaagtcatggaagtcacccgggtcggaggcggcgttggg
atccctggtctgtatgtgacggacgatccaggcggggtcgacgaagccgcccgaaccggc
aacctatcgctccgaatcggtttgggttgggccaagtccctgcacttcaccaccggccag
tgccccgtgatgaagtacaatcgaggcctgatgatggcgattttgcatgaccgatgccag
atcgccaaagcggtcaatgcaacggtgatttcgttggacgatgcccctcaaggctacgcc
gatttcgaccaaggcgccgcgaaaaaattcgtgctcgacccacacggcgtcctggctgct
tccacttaa

DBGET integrated database retrieval system