KEGG   Rhodopirellula baltica: RB3499Help
Entry
RB3499            CDS       T00134                                 

Gene name
rbsK
Definition
(RefSeq) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
rba  Rhodopirellula baltica
Pathway
rba00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RB3499 (rbsK)
Enzymes [BR:rba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     RB3499 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-GeneID: 1794245
NCBI-ProteinID: NP_865545
UniProt: Q7UU55
Position
1811256..1812200
Genome map
AA seq 314 aa AA seqDB search
MTDTMTRPKITVVGSANVDLTFRTPRLPVPGETFAGHSLHQGMGGKGANQAVVAARLGAE
VAFVARVGNDGFATQAIDAYQTDGINTSFVQHSKDQPTGTAAILVDDDAENCIIVVAGAN
AELNADDVRSAKDVIAFSDVVICQLETPVEAALEAFKLARAANVLTMLTPAPAELVSDEL
LSLCDVCVPNKTEIAAITGCSVETQADCAAAAEQLRQRGVRQVALTMGGEGVLVLDRSGM
SLIPASPVKAVDTTGAGDAFTGALAVSLAEGMSLADAATRAGIVAAISVTRVGTQTSFPS
LDEINRWKQAENTA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgacagacacaatgacacgcccgaagatcaccgtcgttggttcggccaatgtggatctg
acgtttcgcacaccgcgattgcccgtgcctggtgaaacctttgcgggacattcgctgcat
caaggcatgggtggcaaaggtgcgaaccaagcggtcgtcgccgcccgactcggtgccgaa
gtcgcctttgtcgctcgcgtcggaaatgacggattcgcgacgcaggccatcgacgcctac
cagacagacggaatcaacacgtccttcgttcaacattccaaagaccagcctaccggcacg
gctgcgattttggtggatgatgatgcagagaactgcatcatcgttgttgcgggcgccaac
gcggaattgaatgcggacgatgttcgatcggcgaaggatgtgatcgcattttccgatgtt
gtgatctgccaattggaaactccagtggaggcggctctcgaggcgttcaaactggctcgt
gcggccaacgtcctgacgatgctcacgccggctcccgcggaacttgtttcggatgaactg
ctttcgctttgcgatgtttgtgtccccaacaagaccgagattgccgccatcacgggttgc
agtgtggagacacaggctgactgtgctgccgccgctgaacagttgaggcaacgtggcgtt
cgacaagttgcactgacgatgggcggcgaaggcgttttggtgctcgaccgatcggggatg
tccctcattcctgcctcacccgtcaaagcggtcgacaccaccggggccggcgatgcattc
actggtgcattggcggtctcgctcgccgaaggaatgtctttggccgacgctgccactcgt
gccgggatcgttgcggccatctcggtcacacgcgtcggcactcaaacatcctttccttcg
ctcgatgaaatcaatcgctggaagcaagctgagaacactgcatga

DBGET integrated database retrieval system