KEGG   Rhodopirellula baltica: RB4131Help
Entry
RB4131            CDS       T00134                                 

Gene name
yjjN
Definition
(RefSeq) zinc-type alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
rba  Rhodopirellula baltica
Pathway
rba00010  Glycolysis / Gluconeogenesis
rba00071  Fatty acid degradation
rba00350  Tyrosine metabolism
rba00625  Chloroalkane and chloroalkene degradation
rba00626  Naphthalene degradation
rba01100  Metabolic pathways
rba01110  Biosynthesis of secondary metabolites
rba01120  Microbial metabolism in diverse environments
rba01130  Biosynthesis of antibiotics
rba01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RB4131 (yjjN)
  Lipid metabolism
   00071 Fatty acid degradation
    RB4131 (yjjN)
  Amino acid metabolism
   00350 Tyrosine metabolism
    RB4131 (yjjN)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RB4131 (yjjN)
   00626 Naphthalene degradation
    RB4131 (yjjN)
Enzymes [BR:rba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RB4131 (yjjN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C NAD_binding_7 Sacchrp_dh_NADP Methyltransf_25 2-Hacid_dh_C Pyr_redox_2 SIS_2 DapB_N TrkA_N Shikimate_DH FAD_binding_3 Cas_Cas02710 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 1796803
NCBI-ProteinID: NP_865917
UniProt: Q7UT38
Position
2126371..2127399
Genome map
AA seq 342 aa AA seqDB search
MKALQLSAPKQWEQIEIDEPSPPGPGEALVRIHRVGVCGTDLGGYLGKFPFFSYPRIPGH
ELGVEVVAVGEGVENVKVGDRCSVEPYINCQKCYSCERGLTNCCESHQTLGVMCDGGLTE
KMILPARKLHPANNLSYEQSALVETLAIGCHAIDRAHVTEKDTVLVIGSGPIGLSAIEFA
RVAGARVIVADLSQTRLDFVTEKMGMTDTIQFDGSEADIEKLEAMTDGRRADVVVDATGN
HHSMRRAMEMAAFGGRVVYVGITQQDLQFPHAPFLHRRELTILASRNALTGDFARIIQLI
ESGVIDTDPWITHHAKFEEVIESFPAWTDPESGVVKAVIHIS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgttgcaactgagtgctccgaaacagtgggagcagatcgaaatcgacgaacca
tcgccgccgggtcccggtgaagcgttggtgcgaattcaccgcgtcggtgtttgcggtacg
gacttgggtggttacctcggtaagttcccattcttttcctacccccgaattcccggccat
gaattgggcgtggaagtcgtcgcggttggcgaaggtgtcgagaacgtgaaggtcggcgat
cgctgcagcgtcgaaccgtacatcaattgccagaagtgttattcctgtgaacgtggtctg
acgaactgctgcgaatcacaccaaacactcggcgtgatgtgcgacggcggactgactgaa
aagatgatcttgcccgcccgcaaactgcatcccgccaacaatctttcttacgagcaatca
gcgctcgttgaaacattggcaattggttgccacgccatcgatcgcgcccatgtgaccgaa
aaggacaccgttttggtgattggttcgggccccattgggttgtcggcgatcgagttcgct
cgtgtcgcaggagccagggtcattgtcgctgacctcagccaaacgcggttggactttgtg
accgagaagatgggcatgaccgacaccattcagtttgatggatccgaagcggacattgaa
aaactggaagcgatgaccgatggtcgtcgcgcggacgttgtggtcgatgcgacgggcaac
catcactccatgcgtcgtgcgatggagatggctgcgttcggcggacgagtcgtctacgtc
gggatcactcagcaagacctgcagttcccgcacgcaccgtttttgcatcgccgtgagttg
acgattctggccagtcgcaatgcgttgactggagattttgctcgcatcattcaattgatc
gagtcgggcgtcatcgacactgatccatggatcacacatcacgcgaaatttgaggaagtc
atcgagtccttcccggcttggacggatccggaatctggcgtcgtgaaagccgtgatccac
atttcctaa

DBGET integrated database retrieval system