KEGG   Rhodopirellula baltica: RB4273
Entry
RB4273            CDS       T00134                                 

Definition
(RefSeq) peroxidase
Organism
rba  Rhodopirellula baltica
SSDB
Motif
Pfam: Dyp_perox
Other DBs
NCBI-GeneID: 1795382
NCBI-ProteinID: NP_865998
UniProt: Q7USV8
Position
complement(2191875..2193431)
AA seq 518 aa
MIEPLLSTDQIQANIAPGFRFPFQHLIAVKSGGADEIRRLISELLPQVTTMDQALRFHES
RLERARQSYNFGISSFRALESHPLWVNVALGNELLMSLIGDSVNDADRSFRLGLHSRSFA
LGDHRDPASEGHRNNWLVGGPDNAADLFLIIGSSDDATLDEGVASLIDTIEGNTHTVIYD
ERGNRLENDQEHFGFRDGVSQPAMRGRVSAGTHDFLAKRRVRNLPTGPEWASPGSPLVWP
GEFVFGYPRQNSNNFRDPSSIANTDDFLKNGSFLVFRRLKQDVRLFREETDKMASELAAH
SEFSHIDAELLRASIVGRWPDGTPMQQSPDGPPAQMTSEERINYFGYGDETCPIELADGR
IVQGTDADADGIVCPFHAHIRKVNPRDRSTDLGAETNTMKMRILRRGIPFGPAYEDAPNE
NNRGLLFLCYQTSIRDQFEQLMFRWVNSTVNPEPGNNEGHDMILGQNGAATDRERFCVFK
NASGSEATVSTRKDWVVPTGGGYFFCPSINSLNQLATA
NT seq 1557 nt   +upstreamnt  +downstreamnt
atgatcgaaccgctactttcgaccgaccagattcaagcgaacatcgcgccgggtttccgt
ttcccattccagcatctcatcgcggtcaagtcggggggagccgatgagattcgtcgattg
attagcgaattgctacctcaggtcaccacgatggatcaggcattgcggtttcacgagagt
cgtttggaacgggcgagacaaagctacaactttgggatatccagctttcgtgccctggaa
tcacaccctttgtgggttaatgtcgctttgggtaacgaactactcatgagtctaattggc
gactcggtaaacgacgcggaccgttcgtttcgtctggggcttcatagtcgtagttttgct
ctcggcgatcatcgcgatccagcaagtgagggacacaggaacaattggctggttggcggt
ccagacaacgcggccgatctgttcttgatcatcgggtcgtccgatgacgccacgttggat
gaaggggttgcgtcactcattgacaccatcgaaggcaatacgcatacggtcatttacgat
gaacgtggcaatcgcctggagaacgatcaagagcattttgggtttcgtgatggagtctcc
cagccggcgatgcgtggtcgagtgtcggccggcacccatgactttctagccaaacgtcgg
gtgcgcaatttgccaaccgggccggaatgggcgtcgccgggatcgcctctggtttggccg
ggtgaattcgtgttcggatacccgcgccagaattcaaacaactttcgcgatccgtcctcg
attgccaacaccgatgactttctgaagaacggttcatttttggttttccgaagactcaag
caggacgttcggctcttccgcgaagagacggacaagatggcgtcggagctagctgcgcat
tcggagttctcacatatcgacgcagaactgctgcgggcgagtatcgttggccgatggccg
gatggaactcccatgcagcagtctcctgatgggccacccgcacaaatgacatccgaagaa
cgaatcaactatttcggctacggcgacgaaacatgtccgattgagttagccgatggccga
atcgttcaagggaccgatgcagacgccgatggcatcgtttgtcctttccacgcacacatc
cgtaaagtgaatcctcgcgaccggtcaacggaccttggagcagaaacaaacacgatgaaa
atgcgaatcctgcgtcgcggaatcccctttggccctgcgtacgaggatgctcccaatgaa
aacaatcgaggacttttgtttctgtgttatcaaaccagcattcgcgatcaatttgagcag
ttaatgttccgctgggtcaattcaacggtgaacccagaaccaggaaacaacgaaggtcat
gacatgatcctcggtcagaatggggcggcaaccgaccgcgagcgattttgcgttttcaaa
aacgcatctggctccgaggcaaccgtttccacgcgaaaagactgggtcgtcccaaccggc
ggcggctacttcttttgcccatcgatcaattcactgaaccaattagccacagcgtaa

DBGET integrated database retrieval system