KEGG   Rhodopirellula baltica: RB4567Help
Entry
RB4567            CDS       T00134                                 

Gene name
chd1
Definition
(RefSeq) cryptic haloacid dehalogenase 1
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
rba  Rhodopirellula baltica
Pathway
rba00361  Chlorocyclohexane and chlorobenzene degradation
rba00625  Chloroalkane and chloroalkene degradation
rba01100  Metabolic pathways
rba01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rba00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RB4567 (chd1)
   00361 Chlorocyclohexane and chlorobenzene degradation
    RB4567 (chd1)
Enzymes [BR:rba01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     RB4567 (chd1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Put_Phosphatase DUF2189 Acid_phosphat_B
Motif
Other DBs
NCBI-GeneID: 1792256
NCBI-ProteinID: NP_866175
UniProt: Q7USD6
Position
complement(2337476..2338300)
Genome map
AA seq 274 aa AA seqDB search
MPMRSFLLLAPLIAIVFANISRAQETQNEAANAKQSSAAIQTEKDSKVTAPKVIVFDVNE
TLLDLAGLKKSVGEALNGREDLLPLWFSNMLHYSLVETMSGEYHDFSEIGTAALMMVAER
EGIELDRESANAAIGHSLRSLPAHADVREGLERLSKQGFRLVSLTNSSKVGVETQLKNAG
LTELFEKRYSIDQIEKYKPHPDTYQMVLDDLGVQPGEVLMVAAHAWDLAGAKNVGLQTAF
VKRPGAVLYSNVQEPDVIVNDLNELADVLSEAKQ
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgccaatgcgatcctttcttcttcttgccccactgattgcaattgttttcgcgaacatt
tcgcgagctcaagagacgcaaaacgaggctgcaaacgcgaagcaatcgtccgccgccatt
caaacagaaaaggactcaaaggtgacagctcccaaagtgatcgtgtttgatgtgaatgaa
acgttgctcgatctggcgggactgaagaagtcggttggagaggctttgaatggtcgagaa
gaccttctgccgctgtggttctccaatatgctgcactactcgttggtggaaacaatgtcg
ggtgaatatcacgactttagtgaaatcggaacggccgcgttgatgatggttgccgaacga
gaagggatcgagctggatcgagaatccgcgaatgctgcgatcggtcattccttgcggtcc
ttgcctgctcacgcggacgttcgagaaggattggaacggctgtcaaaacaggggtttcga
ttggtgagtttgacgaactcttcgaaggttggtgttgagacgcaattgaagaacgccggc
ctcacagagctgttcgaaaaacgctatagcatcgaccaaatcgaaaagtacaagcctcat
ccagacacctatcaaatggttttggatgacttgggtgttcagcccggcgaggttttgatg
gtcgccgcgcatgcgtgggatttggctggggcgaagaacgtcggtttgcaaaccgcattc
gtgaaacggccaggtgcggttttgtattccaacgtccaagagcccgacgtgattgtcaac
gacttgaacgaattggcagacgttttgtcagaggcaaagcaatga

DBGET integrated database retrieval system