KEGG   Rhodopirellula baltica: RB5560Help
Entry
RB5560            CDS       T00134                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rba  Rhodopirellula baltica
Pathway
rba00260  Glycine, serine and threonine metabolism
rba00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rba01100  Metabolic pathways
rba01110  Biosynthesis of secondary metabolites
rba01130  Biosynthesis of antibiotics
rba01230  Biosynthesis of amino acids
Module
rba_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RB5560 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RB5560 (trpA)
Enzymes [BR:rba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RB5560 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-GeneID: 1795027
NCBI-ProteinID: NP_866768
UniProt: Q7URN0
Position
2893360..2894241
Genome map
AA seq 293 aa AA seqDB search
MRPVPSAHPDADPPSMTPLQSLFESLRGQNRKALMPFLTTGDPNIDTTEAVIAAARQAGA
DLCEVGVPYSDPIADGPVIQASYQRALDAGFKLQHVWDLGQRLTENPKVKAMPRVTMVSY
SIIYRIGMAKYVDQAMQAGYCGAIVPDLLVEEAEDLSKICREKGFDLIQLVTPTTTRDRQ
CRIAELSSGFLYYVSVTGITGERTALPTNLVDNVGWLREQTELPICIGFGISGPETAAQL
APVSDGLIVGSAIVRRVADAVEKAKSSGADPVKTAAEEAGDFCHSLRQAIDAA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttgagacctgttccgtccgcccatcctgacgccgatccgccatccatgacgcctctgcaa
agcctgtttgaatcccttcgtggtcaaaaccgcaaagccttgatgccgttcctgacgact
ggcgacccaaacatcgatacgacggaagcggtgatcgcggcagcacgccaagccggggca
gatttatgcgaagtcggtgtcccctacagcgacccgattgcggatggcccggtcatccaa
gcgtcttaccaacgagcactcgacgcaggattcaaacttcaacacgtttgggatctgggt
caacgtctgaccgaaaatcccaaagtcaaagcgatgccgcgtgtcacgatggtcagctac
tcgatcatctaccgaattggcatggccaagtacgtcgaccaggcaatgcaagccgggtac
tgcggcgcgatcgtgcctgatttgttggtcgaagaagcagaggatctgagcaaaatctgc
cgtgagaagggatttgatctgatccaactggttacaccgaccacaacccgagaccgccaa
tgccgcatcgcggaattgtccagcggatttctgtactacgtttccgtgaccgggatcacc
ggtgagcgaaccgccttgccgaccaacttggtggacaacgtcggatggctgcgtgagcaa
actgaattgcccatctgcatcggttttggaatcagcggtccggaaacggccgcacaactc
gcacctgtttctgatggcctgatcgtcggctcagccatcgtccggcgtgtcgccgacgcg
gtcgaaaaggcgaagagctccggagctgatccggtcaagacggccgcagaagaggccggt
gatttctgccattcattgcgacaggcaatcgacgcggcataa

DBGET integrated database retrieval system