KEGG   Rhodopirellula baltica: RB8797Help
Entry
RB8797            CDS       T00134                                 

Definition
(RefSeq) sodium iodide symporter
  KO
K03307  solute:Na+ symporter, SSS family
Organism
rba  Rhodopirellula baltica
Brite
KEGG Orthology (KO) [BR:rba00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    RB8797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SSF
Motif
Other DBs
NCBI-GeneID: 1794611
NCBI-ProteinID: NP_868548
UniProt: Q7UMJ2
Position
complement(4679244..4680872)
Genome map
AA seq 542 aa AA seqDB search
MIAAMAFTGLDYAVLVGYFIAIMAIGFYFWARNRSADDFTAGGRSLPGWLCGLSIFATYL
SSISYLALPGKAFVDNWNAFMYSLAIPVAAAIAVRWFLPLYRSSGEVSAYSLLERRFGLW
ARLFASGFYLLYQIARIGVVMYLMALPMAVLFGWDIRVVILCTGVVVTVYSFVGGIVAVI
WADAIQAIVLLAGALLALAILLMGMPGGPAEVLAVANENEKFSLGDSSFLILSKPTIWVV
LAFGLFDNLRNFGVDQSYVQRYIASSSDKEAAKSVWVGALLYVPVSALFLFIGSSLYAYY
EGHPQDLAEVRTIVAEQKLMQDGVSKEDADYSTLLLETSSKLKDEDLGDRVFPHFIAANL
PQGVRGLLIAAVFAAAMSTVSTSLNSSATLVMSDFYKRLFRQDSTDAQHVGVLRMSTVAW
GAMGTAMALALVRLTDSTLDVWWTLSGVLGAGIVGLFLLGVTVPRLHGGPAITAFAIGGV
AIAWMTISQTNAWPEGWERCANPMDKLMTIVVGPCLMIAIGSIFAATGLVGDQTSRKDWS
ES
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgattgcggcgatggcattcaccggcttggactatgccgtcctagtcggttacttcatc
gcgatcatggcgattgggttttacttctgggcgcgtaaccgttccgctgatgatttcact
gctggtggtcggtcgcttccggggtggttgtgtgggttgtccatcttcgcgacttatctc
agcagcatcagttatctggcgctgcctggcaaagcgtttgtcgacaattggaacgcgttc
atgtattcgctggcgatccccgttgccgctgcgattgcggtgcgatggtttctgccgctc
taccgaagcagcggcgaggtgtcagcgtactccttgctggaacgccgctttggactctgg
gctcgtttgtttgccagtggattctatttgctgtatcagatcgctcgcatcggcgttgtg
atgtacttgatggcactgccaatggcggtgttgttcggttgggacattcgagtggtcatc
ctgtgcaccggagtcgtggtcacggtgtactcgtttgtcggcgggatcgtcgccgtgatt
tgggccgacgcaatccaagcaattgtgttgttggcgggggccttgttggcactggcgatt
ctgttgatggggatgccgggtggtccagcggaagttttggcggtggcaaacgagaacgag
aagttttcgctcggagacagttccttcctcattttgtcaaagccaacgatttgggttgtg
ttggcgttcggtttgtttgacaaccttcgcaattttggcgtcgatcagagctatgtccaa
cgctacatcgcttccagttctgacaaagaagcggctaagagtgtttgggtcggggctttg
ttgtatgtgccggtcagcgcgttgttccttttcattggatcgtcgttgtatgcgtactac
gaaggccatccgcaggacctcgccgaggtgcgaacgattgtggccgagcaaaagttgatg
caggacggtgtgagcaaagaggatgctgattattcaacccttttgttggaaacttcgtcc
aagctgaaagatgaagatttgggcgatcgggtgttcccgcatttcatcgcggcaaatctt
ccgcaaggtgttcgaggcttgttgatcgccgccgtgtttgctgctgcgatgagcacggtg
tccacttcgttgaactcatcggcgacgctggtgatgagcgacttttacaagcgtctgttt
cgccaggactcaacggatgcccagcacgtgggggtgctgaggatgtcgacggttgcttgg
ggagcgatggggacggcgatggctcttgcgctggtgcgtctgaccgacagcacgcttgat
gtctggtggacattgtccggtgtcttaggagccggaatcgtcgggctgtttttgctaggg
gtcaccgtgcctcgcttgcacggcgggccggccattaccgcattcgcgataggtggagtg
gcaatcgcgtggatgaccatttctcaaaccaatgcttggcccgaaggttgggaaagatgt
gccaacccgatggacaagctgatgacaatcgtcgtcggcccatgcttgatgatcgcaatc
ggatcaatctttgctgccacgggattggttggcgatcaaacttcgcgaaaagattggagc
gaaagttga

DBGET integrated database retrieval system