KEGG   Rhodothermaceae bacterium RA: AWN76_006230Help
Entry
AWN76_006230      CDS       T04780                                 

Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
rbar  Rhodothermaceae bacterium RA
Pathway
rbar00260  Glycine, serine and threonine metabolism
rbar01100  Metabolic pathways
rbar01110  Biosynthesis of secondary metabolites
rbar01120  Microbial metabolism in diverse environments
rbar01130  Biosynthesis of antibiotics
rbar01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rbar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AWN76_006230
Enzymes [BR:rbar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     AWN76_006230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1 Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ARA92799
UniProt: A0A1V0DCP4
Position
1493725..1494756
Genome map
AA seq 343 aa AA seqDB search
MIDLRSDTVTRPSEGMRRAMYEAEVGDDVFGEDPTVRRLQDRIAALLGKEAALFVPSGVM
SNQIALKVHTRPGDEVIVERQSHLFNYESGAPGLLSGVQMNVLDGERGTLTGTQVTAAVR
PGYYWEARSRLVWLENTINKAGGTIYPLERIEEVARVARAHHLALHLDGARLWNASAATG
ISEQAYAAPFDTVSVCLSKGLGAPIGSVLAGPADLMQEAHRYRKLFGGGMRQVGILAAAG
LYALDHHRPALAEDHARARRLAEGIATLPAFRIDLDTVETNIVMFDVVDGEAAPVLEALK
AEGVLMVPFGPATIRATTHRDVTHADIDRALAILTRLFGATSC
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacctccggagtgataccgtgacgcgcccgagcgagggcatgcgccgcgccatg
tacgaagccgaagtgggcgatgacgtcttcggcgaggacccgaccgtgcgccggctgcag
gatcgcatcgccgcgctgctggggaaagaagccgcgctgttcgtgccgtccggcgtgatg
agcaaccagatcgcgctgaaggtacacacccggcccggcgacgaagtgatcgtcgagcga
cagagccatctgttcaactacgagtccggcgcgcccggcctgctctcgggggttcagatg
aacgtgctggacggggagcggggtacgctcaccggcacccaggtgacggcagccgtccgg
cccggctattactgggaggcccgctcgcggctggtgtggctggagaacacgatcaacaaa
gcgggcgggacgatctacccgctggagcgcatcgaggaggtggcccgggttgcccgcgcc
caccacctggccctccacctggacggggcgcggctctggaacgcctcggcggccaccggc
atttcggagcaggcctacgccgcgccgttcgacaccgtcagcgtctgcctctcgaagggc
ctcggcgcaccgatcggctcggtgctggccggaccggccgacctcatgcaggaagcgcac
cgctaccgcaagctcttcggcggcggtatgcggcaggtcggcatcctggccgcggcaggc
ctctacgcgctggaccaccaccgcccggccctggccgaagaccacgcccgcgcccgccgc
ctggccgagggcatcgccaccctccccgccttccgcatcgacctcgataccgtcgaaacc
aatatcgtgatgttcgacgtcgtcgacggcgaagccgctccggtgctggaggccctgaag
gccgaaggggtactcatggtgcccttcggaccggccaccatccgcgccaccacccaccgc
gacgttacccacgccgacatcgaccgcgccctcgccatcctgacccggctcttcggcgcc
acctcctgctga

DBGET integrated database retrieval system