KEGG   Rhodothermaceae bacterium RA: AWN76_011640Help
Entry
AWN76_011640      CDS       T04780                                 

Definition
(GenBank) PHP domain-containing protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
rbar  Rhodothermaceae bacterium RA
Brite
KEGG Orthology (KO) [BR:rbar00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AWN76_011640
Enzymes [BR:rbar01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     AWN76_011640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF5001 PHP
Motif
Other DBs
NCBI-ProteinID: ARA93751
UniProt: A0A1V0DFD2
Position
2850771..2851898
Genome map
AA seq 375 aa AA seqDB search
MPRSLLLLVLLALLVPAAPAQHTHKHTGDRAITFPDVPGYQTLVCDFHTHSVFSDGSVWP
NIRVEEAVRDGLDALAITEHLEYQPHAEDIPHPDRNRAYDLAVEFAQAHDLIVIRGSEVT
RSMPPGHVNAIFLKDANALLRDDVRAVFEEVRRQGGFAFWNHPNWTAQRPDGLATLTDLH
RELIAEGLLKGIEVVNDVTYSDEALQIALDHGLTILGTSDIHGLIDWQYEVPEGGHRPVT
LVFATERSEAGIQAALEAGRTVAWFNNLLVGREDVLQPLLEAALTVTDATYPNDDRSVLS
VTIRNTSDAAFLLDNQTDFTFHSDADVITVGPHQSQRLEVKTGRRRTSVRLVFEVLNAVT
APNTHPHLVFDVTVD
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgccccgctccctgctcctcctcgtcctcctggccctgctcgtgccggccgcaccggcc
cagcatacccacaagcacaccggcgaccgggccatcaccttccccgacgtgcccggctac
cagacgctcgtctgcgacttccacacccactcggtcttttccgacggcagcgtctggccg
aacattcgcgtcgaagaagccgtccgcgacgggctggacgccctggcgatcaccgaacac
ctggaataccagccccacgccgaggacatccctcacccggaccgcaaccgcgcctatgac
ctggccgtcgagttcgcgcaggcacacgacctgatcgtgattcgcggctcggaggtgacc
cggtccatgccgcccggccacgtcaacgccatcttcctgaaggatgccaatgccctgctg
cgggacgacgtccgggccgtcttcgaggaggtccgccgccagggcggcttcgccttctgg
aatcatcccaactggaccgcgcagcggcccgacgggctggccacgctcaccgacctgcac
cgcgaactcatcgccgaggggctcctgaagggcatcgaggtggtcaacgacgtcacctac
tcggacgaggcgctgcagatcgcgctggaccacgggctgaccatcctcggcacgtcggac
atccacggcctgatcgactggcagtacgaggtccccgagggcgggcatcgacccgtcacg
ctcgtctttgccacggagcgatccgaggccggcatccaggcagcgctcgaagccgggcgc
accgtcgcctggttcaacaacctgctcgtcggccgcgaggacgtcctccaacccctcctc
gaagccgcactcaccgtcacggacgccacctacccgaacgacgaccgctccgtgctgtcg
gtcacgatccgcaacacctccgacgccgcgttcctgctggacaaccagacggacttcacc
tttcacagcgatgcggacgtgatcaccgtcggcccccaccagtcccagcggctggaagtc
aaaaccggccgccgacgcacgtccgtccggctcgtcttcgaggtcctcaacgccgtcacc
gcgcccaacacccacccccacctggtcttcgacgtcaccgtcgactga

DBGET integrated database retrieval system