KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108513486Help
Entry
108513486         CDS       T04641                                 

Gene name
RALGDS
Definition
(RefSeq) ral guanine nucleotide dissociation stimulator
  KO
K08732  ral guanine nucleotide dissociation stimulator
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04014  Ras signaling pathway
rbb04015  Rap1 signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb05200  Pathways in cancer
rbb05210  Colorectal cancer
rbb05212  Pancreatic cancer
rbb05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    108513486 (RALGDS)
   04015 Rap1 signaling pathway
    108513486 (RALGDS)
   04072 Phospholipase D signaling pathway
    108513486 (RALGDS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108513486 (RALGDS)
   05231 Choline metabolism in cancer
    108513486 (RALGDS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108513486 (RALGDS)
   05212 Pancreatic cancer
    108513486 (RALGDS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF RasGEF_N RA
Motif
Other DBs
NCBI-GeneID: 108513486
NCBI-ProteinID: XP_017704726
Position
Un
AA seq 973 aa AA seqDB search
MAWYKREFLALPVTGAGMTATRVTPGLGTRVLHSTKARRRQAHWQRASRRAHFPPGSHPT
MAREAGQVCARPAVPRVGKGSVFFACVSVVTARRRAIARRVALQSPTPWLAPLPPPTTTE
SSTQEIGEELINGVIYSISLRKVQLHHGANKGQRWLGYENESALNLYETCKVRTVKAGTL
EKLVEHLVPAFQGSDLSYVTIFLCTYRAFTTTQQVLDLLFKRYGRCDALTASSRYGCVLP
YSDEDGGPQDQLKNAISSILGTWLDQYSEDFCQPPDFPCLKQLVAYVQLNMPGSDLERRA
HLLLAQLEHSEPIEAEPEALSPVPAVKPTPELELALTPARAPSPLPVPAPAPTPASGSEL
EVAPPPAPKLQQAPEPAVELEPAPAPAPELEPAPVPPPEQDPAPSQTLELEPAPVPVPSL
EPSWPSPVVAENGLSEEKPHLLMFPPDLVAEQFTLMDAELFKKVVPYHCLGSIWSQRDKK
GKEHLAPTIRATVTQFNSVANCVITTCLGDRSTKAPDRARVVEHWIEVARECRILKNFSS
LYAILSALQSNSIHRLKKTWEDVSRDSFRIFQKLSEIFSDENNYSLSRELLIKEGTSKFA
TLEMNPKRAQKRPKETGIIQGTVPYLGTFLTDLVMLDTAMKDYLYGRLINFEKRRKEFEV
IAQIKLLQSACNNYSITPDEQFGVWFRAVERLSETESYNLSCELEPPSESASNTLRTKKN
TAIVKRWSDRQAPSTELSTSGSSHSKSCDQLRCGPYLSSGDIADALSVHSAGSSSSDVEE
INISFVPESPDGQEKKFWESASQSSPETSGISSASSSTSSSSASTTPVAATRTHKRSVSG
LCNSSSALPLYNQQVGDCCIIRVSLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLEED
EPEDYELLQILSDDRKLKIPENANVFYAMNSTANYDFVLKKRTFTKGVKVKHGASSTLPR
MKQKGLKIAKGIF
NT seq 2922 nt NT seq  +upstreamnt  +downstreamnt
atggcctggtacaagcgggaattcctggccctgcctgtcacaggagcaggtatgacagcc
acgcgggtgacaccaggcctaggcactcgggtgctccactccactaaggcacgtaggcga
caagcacactggcagagggcctcccgcagggcccacttcccacctggctctcaccccact
atggcccgggaagcaggccaggtttgtgccaggcctgctgtgcccagagtagggaagggc
tctgtgttctttgcctgtgtctctgtggtgactgccaggaggagggccatcgcccgccgt
gtcgctctccaaagcccgacaccttggctggcacctctgccaccaccgaccaccactgag
agctccacgcaggagatcggtgaggagctgatcaacggagtcatctactccatctccctg
cgcaaggtgcagctgcaccacggagccaacaagggccagcgctggctcgggtatgagaat
gagtcggccctgaacctttatgagacttgcaaggtgcggaccgtgaaggctggcacgctg
gagaagctggtggagcacctggtgcccgccttccagggcagcgacctctcctacgtcacc
atcttcctgtgtacctacagagccttcaccaccacccaacaggtcctggacctgctgttt
aaaaggtacggtagatgtgacgccctcacggcctcctctagatacggctgcgtccttccc
tattccgacgaggatggcggaccccaggaccaacttaaaaatgccatctcctccatcctg
ggcacctggctggaccagtactcggaggatttctgtcaacccccggactttccctgcctc
aagcagctggtggcctacgtgcagctcaacatgccaggctcagacctggagcgccgtgcc
caccttctcctggcccagctggagcactcggaacccattgaggcagagcctgaggctctg
tcaccagtgccagctgtaaaaccaactccagagctagagctagctctaacaccagctcga
gcacccagcccactgccagtgccagccccagctccaacaccagcttcaggttcagagcta
gaggttgctccaccgccagctccgaagctccagcaggctccagagccagctgtggaacta
gaaccagctccagcgccagctccagaactagagccagctccagtaccacctccagaacag
gatccagctccctcccaaactctagagctggagccagctccagtgccagtgccatcatta
gagccttcctggccttcacctgtggttgcagaaaacgggctgagtgaggagaagcctcac
ctcttgatgttccctcccgacttggtagcagagcagtttacactgatggatgcggagctg
ttcaagaaggtggtgccctaccactgcctgggctctatctggtcgcagcgggacaagaag
ggcaaggagcacctggcacccaccatccgcgccactgtcacccagttcaacagcgtggcc
aactgcgtcatcaccacctgcctcggggaccgaagcacaaaagccccagaccgggccagg
gtggtggagcactggatcgaggtggccagggagtgccggatcctcaagaacttctcgtca
ctgtatgccatcctctctgccctgcagagcaactccatccaccggctgaagaagacgtgg
gaagacgtttccagggacagttttcggatctttcagaagctgtcggagatcttctcagat
gagaacaactactcattgagccgggagctgctcatcaaggaggggacctccaagtttgcc
accctggagatgaaccccaagagagcccagaaacggccaaaggagacgggcatcatccag
ggcaccgttccctacctgggcacgttcctcaccgacctggtgatgctggacaccgccatg
aaggactatctgtatggcagactcatcaacttcgagaagaggaggaaggagttcgaggtg
atcgcccagatcaagctgctgcagtcagcctgcaacaactacagcatcacgccagatgag
cagtttggggtctggttccgggccgtagagcggctcagcgagactgagagctacaacctg
tcgtgcgagctggagcccccatccgagtcagccagcaacaccctcaggaccaagaagaac
acagccattgtcaagcgctggagcgaccgccaggcccccagcactgagctcagtaccagc
ggcagctcccactccaagtcctgtgaccagctcaggtgtggcccctacctcagcagcggg
gacattgctgacgcgctcagcgtgcactcagccggctcctccagctctgacgtggaggag
atcaacatcagcttcgtcccggagtcccctgatggccaggaaaagaagttctgggaatca
gcctcacagtcgtccccggagacctccggcatcagctcggcctccagcagcacctcgtcc
tcctcagcctccaccacacccgtggctgccacacgcacccacaaacgctccgtctcaggg
ctctgcaactccagctccgcgctgccgctctacaaccagcaggtgggcgactgctgcatc
atccgcgtcagcctggacgtggacaacggcaacatgtacaagagcatcctggtgaccagc
caagataaggctccggccgtaatccgcaaggccatggacaaacacaacctggaggaagat
gagccggaggactatgagctgctgcagattctctccgatgaccggaagctgaagatccct
gaaaacgccaatgtcttctatgccatgaactctaccgccaactatgactttgtcctgaag
aagcggaccttcaccaagggagtgaaggtcaagcatggagccagctcaaccctccctcgc
atgaagcagaaaggactcaagattgccaagggcatcttctga

DBGET integrated database retrieval system