KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108514747Help
Entry
108514747         CDS       T04641                                 

Gene name
PARP16
Definition
(RefSeq) poly(ADP-ribose) polymerase family member 16
  KO
K00774  poly [ADP-ribose] polymerase 16 [EC:2.4.2.30]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    108514747 (PARP16)
Enzymes [BR:rbb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     108514747 (PARP16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP ARTD15_N
Motif
Other DBs
NCBI-GeneID: 108514747
NCBI-ProteinID: XP_017706684
UniProt: A0A2K6ME95
Position
Un
AA seq 322 aa AA seqDB search
MQPSGWAAAREATGRDMLAADLRCSLFASALQSYKRDSVLRPFPASYARGDCKDFEALLA
DASKLPNLKELLQSSGDNHKRAWDLVSWILSSKILTIHSAGKAEFEKIQKLTGAPHTPVP
APDFLFEIEYFDPANAKFYETKGERDLIYAFHGSRLENFHSIIHNGLHCHLNKTSLFGEG
TYLTSDLSLALIYSPHGHGWQHSLLGPILSCVAVCEVIDHPDVKCQTKKKDSKEIDRRRA
RIKHSEGGDIPPKYFVVTNNQLLRVKYLLVYSQKPPKRTSSQLSWFSSHWFTVMISLYLL
LLLIVSVINSSAFQHFWNRAKR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcagccctcaggctgggcggccgccagggaggcgacgggccgcgacatgttggctgcc
gacctccggtgcagcctcttcgcctcggccctgcagagctacaagcgcgactcggtgctg
cggcctttccccgcgtcctacgcccgcggcgactgtaaggattttgaagccctgctcgca
gatgccagcaagttacctaacctgaaagaacttctccagtcctctggagacaatcacaaa
cgggcctgggacctggtgagctggattttatcctcaaagatcctgacaatccacagtgca
ggaaaggcagagtttgaaaagatccaaaagctgactggggctcctcacacgcctgttccc
gcaccggacttcctgtttgaaattgaatactttgacccagccaacgccaaattttatgag
accaaaggagaacgagacctaatctatgcctttcatggtagtcgcctagaaaacttccat
tccattatccacaatggcctgcactgccatctgaacaagacatccttgttcggagagggg
acctacctcaccagtgacttgagcctggccctcatatacagcccccacggccacgggtgg
cagcacagcctcctcggccccatccttagctgtgtggctgtgtgtgaggtcattgaccat
ccggacgtcaagtgccaaaccaagaagaaggattccaaggagatagatcgcagacgagcg
agaatcaaacatagtgaagggggagacatccctcccaagtactttgtggtcaccaataac
cagctcctgcgagtgaagtacctcctggtgtattcacagaagccacccaagaggacttcg
agccagctctcctggttttccagccattggtttaccgtcatgatatccctgtatctgctg
ctgctgctcatagtgagtgtcatcaactcctctgctttccaacacttttggaatcgtgca
aaaagataa

DBGET integrated database retrieval system