KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108517161Help
Entry
108517161         CDS       T04641                                 

Gene name
OTC
Definition
(RefSeq) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00220  Arginine biosynthesis
rbb01100  Metabolic pathways
rbb01230  Biosynthesis of amino acids
Module
rbb_M00029  Urea cycle
rbb_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    108517161 (OTC)
Enzymes [BR:rbb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     108517161 (OTC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-GeneID: 108517161
NCBI-ProteinID: XP_017710446
Position
Un
AA seq 252 aa AA seqDB search
MLFNLRILLNNAAFRNGHNFVVRNFRYVLSSMTDAVLARVYKQSDLDTLAKEASIPIING
LSDLYHPIQILADYLTLQEHYSSLKGLTLSWIGDGNNILHSIMMSAAKFGMHLQAATPKG
YEPDPSVTKLAEQYAKENGTKLLLTNDPLEAAHGGNVLITDTWISMGQEEEKKKRLQAFQ
GYQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSPRSLVFPEAENRKWTIMAVMVSLL
TDYSPQLQKPKF
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgctgtttaatctgaggatcctgttgaacaatgcagcttttagaaatggtcacaacttc
gtggttcgaaattttcggtatgtattgtctagcatgacagatgcagtattggctcgagtg
tataaacaatcagatttggacaccctggctaaagaagcatccatcccaattatcaatggg
ctgtcagatttataccatcctatccagatcctggctgattacctcacgctccaggaacac
tatagctctctgaaaggtcttaccctcagctggatcggggatgggaacaatatcctgcac
tccatcatgatgagcgcagcgaaattcgggatgcaccttcaggcagctactccaaagggt
tatgagccggatcctagtgtaaccaagttggcagagcagtatgccaaagagaatggtacc
aagctgttgctgacgaatgatccattggaagcagcgcatggaggcaatgtattaattaca
gacacttggataagcatgggacaagaagaggagaagaaaaagcggctccaggctttccaa
ggttaccaggttacaatgaagactgctaaagttgctgcctctgactggacatttttacac
tgcttgcccagaaagccagaagaagtggacgatgaagtcttttattctccacgatcacta
gtgttcccagaggcagaaaacagaaagtggacaatcatggctgtcatggtgtccctgctg
acagattactcacctcagctccagaagcctaaattttga

DBGET integrated database retrieval system