KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108517617Help
Entry
108517617         CDS       T04641                                 

Gene name
PLA2G4F
Definition
(RefSeq) phospholipase A2 group IVF
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00564  Glycerophospholipid metabolism
rbb00565  Ether lipid metabolism
rbb00590  Arachidonic acid metabolism
rbb00591  Linoleic acid metabolism
rbb00592  alpha-Linolenic acid metabolism
rbb01100  Metabolic pathways
rbb04010  MAPK signaling pathway
rbb04014  Ras signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04217  Necroptosis
rbb04270  Vascular smooth muscle contraction
rbb04370  VEGF signaling pathway
rbb04611  Platelet activation
rbb04664  Fc epsilon RI signaling pathway
rbb04666  Fc gamma R-mediated phagocytosis
rbb04724  Glutamatergic synapse
rbb04726  Serotonergic synapse
rbb04730  Long-term depression
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04912  GnRH signaling pathway
rbb04913  Ovarian steroidogenesis
rbb04921  Oxytocin signaling pathway
rbb05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    108517617 (PLA2G4F)
   00565 Ether lipid metabolism
    108517617 (PLA2G4F)
   00590 Arachidonic acid metabolism
    108517617 (PLA2G4F)
   00591 Linoleic acid metabolism
    108517617 (PLA2G4F)
   00592 alpha-Linolenic acid metabolism
    108517617 (PLA2G4F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    108517617 (PLA2G4F)
   04010 MAPK signaling pathway
    108517617 (PLA2G4F)
   04370 VEGF signaling pathway
    108517617 (PLA2G4F)
   04072 Phospholipase D signaling pathway
    108517617 (PLA2G4F)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108517617 (PLA2G4F)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108517617 (PLA2G4F)
   04664 Fc epsilon RI signaling pathway
    108517617 (PLA2G4F)
   04666 Fc gamma R-mediated phagocytosis
    108517617 (PLA2G4F)
  09152 Endocrine system
   04912 GnRH signaling pathway
    108517617 (PLA2G4F)
   04913 Ovarian steroidogenesis
    108517617 (PLA2G4F)
   04921 Oxytocin signaling pathway
    108517617 (PLA2G4F)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108517617 (PLA2G4F)
  09156 Nervous system
   04724 Glutamatergic synapse
    108517617 (PLA2G4F)
   04726 Serotonergic synapse
    108517617 (PLA2G4F)
   04730 Long-term depression
    108517617 (PLA2G4F)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108517617 (PLA2G4F)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    108517617 (PLA2G4F)
Enzymes [BR:rbb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     108517617 (PLA2G4F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 108517617
NCBI-ProteinID: XP_017711173
Position
Un
AA seq 832 aa AA seqDB search
MAPLSPLCGDQDRRLIPGLMAPDRVGGGTGADHGGPGPSPVLPAVSKADCYVQLWLPTAS
PSPAQTRTVANCSDPEWNETFHYQIHGAVKNVLELTLYDKDILDSDQLSLLLFDLRSLKC
GQPHRHTFPLNHQDSQELQVEFALEKSQVPASETITNGVLVAHPCLRIQGTLRGDGTAPR
EEYGSRQLLLTVPGAYEKPQLLPLQPPTEPGLQPTFIFHVSPVLSSRLHVELMEQLSAVQ
SDPSAELEAQTSKLGQGGVLLSSLPLGQEEQCSVALGEGQEVALSVKVEMSSGDLDLRLG
FDLCDGEQEFLDRRKQVVAKALQQVLGLSEAPNSGQVPVVAVLGSGGGTRAMSSLYGSLA
GLQELGLLDTVTYLSGVSGSTWCISTLYRDPAWSQVALQGPIERAQVHVCSSKMGALSTE
RLQYYIQELGVRERSGHSMSLVNLWGLLVEYFLYQEENPAKLSDQQEAVRQGQNPYPIYT
SVNVRTNMSGEDFAEWCEFTPYEVGFPKYGAYVPTELFGSELFMGRLLQLQPEPRICYLQ
GVWGSAFATSLDEIFLKTAGSGLSFLERYRGSVNITDNCQKPQPHNPSRLRTRLLTPQGP
FSQAVLDIFTSRLTSAQSFNFTRGLCLHKDYVAGREFVAWKDTHPDAFPNQLTPMRDCLY
LVDGGFAINSPFPLALRPQRAVDLILSFDYSLEAPFEVLKMTEKYCLDRGIPFPSIEVGP
EDMEEARECYLFAKTEDPRSPIVLHFPLVNHTFRTHLAPGVERQTAEEKAFGDFVINRPD
TPYGMMNFTYEPQDFDRLVALSRYNVLNNVETLKHALQLALDRHQARERTGG
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctttgtctccgctttgcggagatcaagaccgtcggctaattccgggcctcatg
gctccggacagagtaggtggagggactggtgctgaccatggaggccccggcccctcccct
gtcctacctgcagtgtccaaagccgactgctacgtgcaactgtggctgcccacggcatcc
cccagccctgcccagactaggacagtggccaactgcagtgaccccgagtggaatgagact
ttccactaccagatccatggtgctgtgaagaatgttctggagctcactctctatgacaag
gacatcctggacagcgaccagctctccctgctcctgtttgacctgaggagcctcaagtgt
ggccaacctcacagacacaccttcccactcaaccaccaggattcacaagagctgcaggtg
gaatttgctctggagaagagccaggtgcctgcatctgaaaccatcaccaacggggttctg
gtggctcacccctgtctaagaatccagggcacactccggggagatgggacagccccacgg
gaagagtacggctctcggcagctcctgctgacagtgcctggggcctacgagaagccacag
ctcttgcccctgcagcctcccacagagccaggcctccaacccacctttatcttccacgtg
agcccagtgctgagctccaggctacacgtggagctgatggagcagctctcagctgtgcag
agcgaccccagcgcggagctggaggctcagaccagcaagctgggccaggggggcgtcctg
ctctcctctctgcccctaggccaggaggaacagtgttctgtggccctgggggagggccag
gaggtggctctgagtgtgaaggtggaaatgagctccggggacctagacctacgccttggc
tttgacctctgcgacggggagcaggagtttctggacaggaggaagcaggtcgtggccaag
gccctgcagcaggtgctgggattgagcgaggctcccaacagtggccaggttcctgtagtg
gctgtgttgggttccgggggtggaacccgagccatgtcttctctgtacggcagcctggca
gggttgcaggagctcggcctgctagacactgtgacctacctgagtggggtctctgggtcc
acctggtgcatctccacactctacagggacccagcctggtcccaggtggccttgcagggc
cccattgagcgtgcccaggttcacgtctgcagcagtaagatgggagctttgtccacggag
cggctacagtactacattcaggaactgggggtccgggagcgcagtggccacagcatgtcc
ctcgtcaacctctggggcctccttgtggagtatttcctgtaccaggaggagaaccctgcc
aagctgtctgaccaacaggaggcggtccgccagggtcagaacccttaccccatttacacc
agcgtcaacgtccgcaccaacatgagtggggaagattttgcagagtggtgcgagttcacg
ccctacgaggtcggcttccccaagtacggggcttatgttcccaccgagctctttggctca
gagcttttcatgggacgattgctgcagctccagcccgagccccggatctgctacctgcaa
ggtgtgtggggcagcgcctttgccaccagcctggatgagatcttcctaaagactgcgggc
tcgggcctcagcttcctggagcggtacagaggcagtgtgaatatcacagataactgccag
aagcctcagccgcacaacccatcgaggctgcgaacaagactccttaccccgcaggggccc
ttctcccaggctgtgctggacatattcacctcccgcctcacttctgcccaaagctttaac
ttcacccggggtctctgcttgcacaaggactatgtggctggcagagagttcgtggcctgg
aaagacacacacccagacgccttccccaaccagctcaccccgatgcgggactgcctgtac
ctggtggacggaggctttgccatcaactctccgttcccactggctctgcgacctcagaga
gccgtggacctcattctgtcctttgactattccttggaagctccttttgaggtcttgaag
atgacagagaagtactgcctggaccgaggaatccccttccctagcattgaggtgggccct
gaagacatggaggaggctcgtgagtgctatctgtttgccaagactgaggacccccgctcc
cccatcgtgctgcacttcccccttgtcaaccacaccttccgcacacacctggccccaggt
gtggagcgacaaacagctgaggagaaggcctttggggactttgtcatcaacaggccagac
accccctatggcatgatgaacttcacctacgagccccaggactttgatcggctggtggcc
ctgagtcgatacaatgttctgaacaatgtggagaccctgaagcatgccctccagctggct
ctggaccggcaccaggctcgggagaggactgggggctga

DBGET integrated database retrieval system