KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108518884Help
Entry
108518884         CDS       T04641                                 

Gene name
THNSL2
Definition
(RefSeq) threonine synthase like 2
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    108518884 (THNSL2)
Enzymes [BR:rbb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     108518884 (THNSL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 108518884
NCBI-ProteinID: XP_017713067
Position
Un
AA seq 497 aa AA seqDB search
MKLASRIMWYVSTRGIAPRVNFEGALFSGYAPDGGLFMPEELPQLDRETLCRWSTLSYPD
LVKELCALFIGSELIPKDDLNDLIDRAFSRFRHKEVVRLSRLKNGLNVLELWHGVTYAFK
DLSLSCTAQFLQYFLEKREKHVTVVVGTSGDTGSAAIESVKGAKNVDIIVLLPKGHCTKI
QELQMTTVLKENVHVFGVEGNSDELDEPIKTVFADVAFVKKHNLMSLNSINWSRVLVQMA
HHFLAYFQCTPSLDTHPLPLVEVVVPTGAAGNLAAGYIAQKIGLPIRLVVAVNRNDIIHR
TVQQGDFSLSKAVKSTLASAMDIQLGLGEVPYNMERVFWLLSGSDSQVTRALMEQFERTQ
SVNLPKELHSKLSEVVTSESVSDEAITQTMGRCWDENQYLLCPHSAVAVNYHYQQMDRQQ
PSSTPRCCLAPASAAKFPEAVLAAGLTPETPAEIVALEHKETRCTLMQRGDNWTLMLRDT
IEDLSRRWRGHALNASQ
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaagctggcctccaggatcatgtggtacgtcagcaccaggggcatagccccacgggtc
aactttgagggggccctcttctctggctatgcacccgatggaggcctctttatgccggaa
gagctcccacagttggacagagagaccctgtgccggtggagcacactctcctatcctgac
ctggtgaaggagctgtgcgccctcttcatcggctctgagctcattccgaaagatgactta
aatgatctgattgaccgagccttcagcagattccgtcacaaagaggtggtccgtctgtcc
aggttgaagaatgggctgaacgtgttggagctgtggcatggtgtcacatatgcatttaag
gacctgtccctgtcctgcacagcacagttcctgcagtacttcctggagaagagggagaag
cacgtcactgtggttgtaggaacgtctggggacacaggaagtgctgccattgagagtgtt
aaaggggcaaagaacgtggacattatcgttctgctgcccaaaggtcactgcacaaagatt
caggagctccagatgacaacggtgctgaaggagaacgtacatgtgtttggagtggaggga
aacagcgatgagctcgatgagccaatcaagactgtgtttgccgacgtggcttttgtcaag
aagcacaatctgatgagcctgaattcgatcaactggtcccgggtcctggtgcagatggcc
caccacttccttgcttacttccagtgtacgccatccttggacacgcatcccctacccctg
gtggaggtggttgtgccaacaggggctgccggtaaccttgcagctgggtacattgctcag
aagataggcctgcccatccgtctggtcgtggcagtgaatcgcaatgacatcatccacagg
actgtccagcagggagacttctctctgtcgaaggctgttaaatcaaccttggcatcagct
atggacattcagctaggcctgggggaggtgccctacaacatggagagggtattctggcta
ctctctggctctgacagccaggtaacaagagccctcatggagcagtttgaaaggacccaa
agtgtgaatctgcccaaggaactgcacagcaagctttcagaggtggtgacatccgagtca
gtgtctgatgaagccatcacccagaccatgggccgctgctgggatgagaaccagtacttg
ctgtgcccccactcggcagtggctgtgaactaccattaccagcagatggacaggcagcag
cccagcagcactccccggtgctgccttgcccctgcctctgcagccaagtttccggaagct
gtcctggctgctggcctgacccctgagactcctgcagagatcgtagccctggagcacaag
gagacacgctgcaccctgatgcagagaggtgacaactggaccctgatgcttcgggacacc
attgaggaccttagccgacggtggaggggtcatgccctcaacgcctcccagtag

DBGET integrated database retrieval system