KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108520330
Entry
108520330         CDS       T04641                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rbb01002]
    108520330 (ERAP1)
Enzymes [BR:rbb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     108520330 (ERAP1)
Peptidases and inhibitors [BR:rbb01002]
 Metallo peptidases
  Family M1
   108520330 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 108520330
NCBI-ProteinID: XP_017715151
Position
Un
AA seq 940 aa
MVFPSLKWSLPTMSFLPSLLLALLTVSTPSWCQSSEASPKGSNGMPFPWNKIRLPEYVIP
VHYDLLIHANLTTLTFWGTTEVEITASQPTSTIILHSHHLQISRATLRKGAGERLSEEPL
QVLEHPPQEQIALLAPEPLLVGLLYTVVIHYAGNLSETFHGFYKSTYRTKEGELRILAST
QFEPTAARMAFPCFDEPAFKASFSIKIRREPRHLAISNMPLVKSVTVAEGLIEDHFDVTV
RMSTYLVAFIISDFESVSKITKSGVKVSVYAVPDKINQADYALDAAVTLLDFYEDYFNIP
YPLPKQDLAAIPDFQSGAMENWGLTTYRESALLFDAEKSPASSKLGITMIVAHELAHQWF
GNLVTMEWWSDLWLNEGFAKFMEFVSVSVTHPELKVEDYFFGKCFDAMEVDALNSSHPVS
TPVENPAQIREMFDDVSYDKGACILNMLREYLSADAFKSGIVQYLQKHSYKNTKNEDLWD
SMASICPTDGVKGMDGFCSGSQHSSSFSHWHQEGLDVKTMMNTWTLQKGFPLITITVRGR
NVHMKQEHYMKGSEGAPDTGYLWHVPLTFITSKSDMVHRFCXNKTDVLILPEEVEWIKFN
VGMNGYYIVHYEDDGWDSLTGLLKGTHTAVSSNDRASLINNAFQLVSIGKLSIEKALDLS
LYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKAFLIRLLRDLIDKQTWTDEGS
VSERMLRSQLLLLACVRKYQPCVQRAEGYFRKWKESNGNLSLPIDVTLAVFAVGAQSTEG
WDFLYSKYQSSLSSTEKKQIEFALCTTQNKEKLQWLLDESFKGDKIKTQEFPEVLVLIGR
NPVGYPLAWKFLRKNWNKLVQKFELGSRSIAHMVMGTTNQFSTRTWLEEVKGFFSSLKEN
GSQLRCVQQTIETIEENIRWMDKNFDKIRVWLQSEKFELL
NT seq 2823 nt   +upstreamnt  +downstreamnt
atggtgtttccgtccctcaaatggtcccttccaaccatgtcatttctaccttccttactg
ttggctctcttaactgtgtccactccttcatggtgtcagagcagtgaagcatctccaaaa
ggtagtaatgggatgccatttccttggaataaaataagacttcctgagtatgtcatccca
gttcattatgatctcctgatccatgcaaaccttaccacgctgaccttctggggaaccaca
gaagtagaaataacagccagtcagcccaccagcaccatcatcctgcatagtcaccacctg
cagatatctagggccaccctcaggaaaggagctggagagaggctatcggaagaaccgctt
caggtcctggaacaccctcctcaggagcaaatcgcgctgctggctcctgagcccctcctt
gtcgggctcctgtacacagttgtcattcactatgctggcaatctttcggagactttccac
ggattttacaaaagcacctacagaaccaaggaaggggaactgaggatacttgcatcaaca
caatttgaacccactgcagctagaatggcctttccatgttttgatgaacctgccttcaaa
gcaagtttctcaatcaaaattcgaagagagccaaggcacctagccatctccaatatgcca
ctggtgaaatctgtgactgttgctgaaggactcatagaagaccattttgatgtcactgtg
aggatgagtacctatctagtggccttcattatttcagattttgagtctgtcagcaagata
accaagagtggagtcaaggtttctgtatatgctgtgccagacaagataaatcaagcagat
tatgcactggatgctgcggtgactcttctagatttttatgaggattatttcaacataccg
tatcccctacccaaacaagatcttgctgctattcccgactttcaatctggtgctatggaa
aactggggactaacaacatatagagaatctgctctattgtttgatgcggaaaagtctcct
gcatcaagtaagcttggcatcacaatgattgtggcccatgaactggcccaccagtggttt
gggaacctggtcactatggaatggtggagtgatctttggctaaatgagggatttgccaaa
tttatggagtttgtgtctgtcagtgtgacccatcctgaactgaaagttgaagattatttc
tttggcaaatgttttgatgcaatggaggtagatgctttaaattcctcacaccctgtgtct
acacctgtggagaatcctgctcagatccgggagatgtttgatgatgtttcttatgataag
ggagcttgtattctgaatatgctaagggagtatcttagtgctgatgcatttaaaagtggt
attgtacagtatctccagaagcatagctataaaaatacaaaaaacgaggacctgtgggat
agtatggcaagtatttgccctacagacggtgtaaaagggatggatggcttttgctctgga
agtcaacattcatcttcattctcacattggcatcaggaaggactggatgtgaaaaccatg
atgaacacttggacactgcagaagggttttcccctgataaccatcacagtgagggggagg
aatgtacacatgaagcaagagcactacatgaagggctctgaaggcgccccggacactggg
tacctgtggcatgttccattgacgttcatcaccagcaaatcagacatggtccatcgattt
tgctaaaacaaaacagatgtgctcatcctcccagaagaggtggaatggatcaaatttaat
gtgggcatgaatggctattacattgtgcattacgaggatgatggatgggactctttgact
ggccttttaaaaggaacacacacagcagtcagcagtaatgatcgggcgagtctcattaac
aatgcatttcagctcgtcagcattgggaagctgtccattgaaaaggccttggatttatcc
ctgtacttgaaacatgaaactgaaattatgcccgtatttcaaggtttgaatgagctgatt
cctatgtataagttaatggagaaaagagatatgaatgaagtggaaactcaattcaaggcc
ttcctcatcaggctgctaagggacctcattgataagcagacgtggacagacgaaggctcg
gtctcagagcgaatgctgcggagtcagctactcctcctcgcctgtgtgcgcaagtatcag
ccgtgtgtacagagggcagaaggctatttcaggaagtggaaggaatccaatggaaacttg
agcctgcctatcgatgtgaccttggcagtgtttgctgtgggggcccagagcacagaaggc
tgggattttctttatagtaaatatcagtcttctttgtccagtactgagaaaaaacaaatt
gaatttgccctgtgcacaacccaaaataaggaaaagcttcaatggctactagatgaaagc
tttaagggagataaaataaaaactcaggagtttccagaagttcttgtactcattggcagg
aacccagtaggatacccactggcctggaaatttctgaggaaaaactggaacaaacttgta
cagaagtttgaacttggctcacgttccatagcccacatggtaatgggtacaacaaatcaa
ttctccacaagaacatggcttgaagaggtaaaaggattcttcagctctttaaaagaaaat
ggttctcagctccgttgtgtccaacagacaattgaaaccattgaagaaaacatccgttgg
atggataagaattttgataaaatcagagtgtggctgcaaagtgaaaagtttgaacttctg
taa

DBGET integrated database retrieval system