KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108521311Help
Entry
108521311         CDS       T04641                                 

Gene name
HSD17B2
Definition
(RefSeq) hydroxysteroid 17-beta dehydrogenase 2
  KO
K13368  17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) [EC:1.1.1.62 1.1.1.239]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00140  Steroid hormone biosynthesis
rbb01100  Metabolic pathways
rbb04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    108521311 (HSD17B2)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    108521311 (HSD17B2)
Enzymes [BR:rbb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     108521311 (HSD17B2)
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     108521311 (HSD17B2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Ins_allergen_rp Epimerase Glucos_trans_II
Motif
Other DBs
NCBI-GeneID: 108521311
NCBI-ProteinID: XP_017716575
UniProt: A0A2K6M1U9
Position
Un
AA seq 387 aa AA seqDB search
MSTFFSDTAWICLAVPTVLCGTVYCKYKKSSGQLWNWMVCLAGLCAVCLLILSPFWGLIF
LSLSCFLMYTYLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPG
AEELRRTCSPRLSVLQMDVTKPVQIKDAYSKVAAMLQDRGLWAVVNNAGVLGFPSDGELL
PMTDYKQCMAVNFFGTVEVTKTFLPLLRKSKGRLVNVSSMGGGAPMAKLASYGSSKAAVT
MFSSVMRIELSKWGIKVVSIQPGGFRTSIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYI
LSQRNFLLFINSEASTDFSPVLRDIQHAISAKSPFAYYTPGKGAYLWLCLAFYLPIGIYN
YLIERNFGKDKPMPRALSMPNYKRKAT
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgagcactttcttctcggacacagcatggatctgcctggctgtccccacagtactgtgc
gggacagtatattgcaaatacaagaagagctcggggcagctgtggaactggatggtgtgc
ctggcgggcctctgtgcagtctgcctactcatcctgtcccctttttggggcttgatcttc
ttatctctgtcatgtttcctcatgtatacttacttatctggccaagagttgttacctgtg
gatcagaaggcagtcctggtgacaggtggtgattgcgggcttggtcacgctttgtgcaag
tatctggatgagctgggcttcacagtatttgccggagttttgaatgaaaatggcccagga
gctgaggaattgcgaagaacctgctccccgcgcctctcggtgctccaaatggacgtcacg
aagccagtgcagataaaagatgcttacagcaaggttgcagcaatgctgcaggacagagga
ttgtgggctgtggtcaacaatgctggggtgcttggctttccatctgatggggagcttctt
cctatgactgactacaaacaatgcatggccgtgaacttctttggaactgtggaggtcaca
aagacatttttgccccttcttaggaaatccaaaggaaggctggtgaatgtcagcagcatg
ggaggaggggccccaatggcaaagctggcatcttatggctcatcaaaggcggctgtgacc
atgttctcatcagttatgagaatcgagctttccaagtggggaattaaagttgtttccatc
caacctggaggcttccgaacaagtatcgcaggcacgagtgacaagtgggaaaagctagag
aaggacattctggaccacctacccgctgaggttcaggaagactacggccaggactacatc
ttatcgcagaggaatttcctcctattcatcaactcggaggccagcacggacttctctccg
gtgctgcgggacatccagcatgctatctcggcgaagagcccctttgcctattacacgcca
gggaaaggcgcttacttgtggctctgtcttgctttctatttgcctattggcatatataat
tacttgattgaaagaaattttggcaaagacaagcccatgcccagagctctaagcatgcct
aactataagaggaaggccacctag

DBGET integrated database retrieval system