KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108525154Help
Entry
108525154         CDS       T04641                                 

Definition
(RefSeq) heat shock 70 kDa protein
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb03040  Spliceosome
rbb04010  MAPK signaling pathway
rbb04141  Protein processing in endoplasmic reticulum
rbb04144  Endocytosis
rbb04213  Longevity regulating pathway - multiple species
rbb04612  Antigen processing and presentation
rbb04915  Estrogen signaling pathway
rbb05134  Legionellosis
rbb05145  Toxoplasmosis
rbb05162  Measles
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    108525154
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108525154
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108525154
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108525154
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    108525154
  09152 Endocrine system
   04915 Estrogen signaling pathway
    108525154
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    108525154
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    108525154
  09172 Infectious disease: viral
   05162 Measles
    108525154
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108525154
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70
Motif
Other DBs
NCBI-GeneID: 108525154
NCBI-ProteinID: XP_017721707
Position
Un
AA seq 165 aa AA seqDB search
NKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLEVTPLSLGIETAGGVMAVLIKLNTT
IPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPQGVPQIEVTFD
IDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAKK
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
aataagagcatcaaccctgatgaagctgttgcttatggtgcagctgtccaggcagccatc
ctgtctggagacaagtctgaaaatgttcaagatttgttgctcttggaagtcactcctctt
tcccttggtattgaaactgctggtggagtaatggccgtccttattaagcttaataccacc
attcctaccaagcagacacagaccttcactacctattctgacaaccagcctggtgtgctt
attcaggtttatgaaggtgagcgtgccatgacaaaggataacaacctgcttggcaagttt
gaactcacgggcatacctcctgcaccccaaggtgttcctcagattgaagtcacttttgac
attgatgccaatggtatcctcaatgtgtctgctgtggacaagagtacaggaaaagagaat
aagattactatcactaatgacaagggccgtttgagtaaggaagacattgaacgtatggtc
caggaagctaagaag

DBGET integrated database retrieval system