KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108526988Help
Entry
108526988         CDS       T04641                                 

Gene name
AMT
Definition
(RefSeq) aminomethyltransferase
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00260  Glycine, serine and threonine metabolism
rbb00630  Glyoxylate and dicarboxylate metabolism
rbb00670  One carbon pool by folate
rbb01100  Metabolic pathways
rbb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    108526988 (AMT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    108526988 (AMT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    108526988 (AMT)
Enzymes [BR:rbb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     108526988 (AMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-GeneID: 108526988
NCBI-ProteinID: XP_017723568
UniProt: A0A2K6MGZ6
Position
Un
AA seq 403 aa AA seqDB search
MQRVVSVVAHLGFRLQALPPALCRPLSCAQDVLRRTPLYDFHLAHGGKMVAFAGWSLPVQ
YRDSHTDSHLHTRQHCSLFDVSHMLQTKIFGSDRVKLMESLVVGDIAELRPNQGTLSLFT
NEAGGILDDLIVTNTSEGHLYVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALL
ALQGPTAAQVLQASVADDLKKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPAAGA
VHLATALLKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRQAAM
DFPGAKVIVPQLKGKVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSGCPSPSLKKNV
AMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYTLK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcagagggttgtaagtgtggtggcccatctgggctttcgcttgcaggcattgcccccg
gccttgtgtcgtccactcagttgcgcacaggacgtgctccgcaggacaccgctctatgac
ttccacctggcccacggcgggaaaatggtggcgtttgcgggttggagtctgccagtgcag
taccgggacagtcacactgactcgcacctgcacacacgccagcactgctcgctctttgac
gtgtctcatatgctgcagaccaagatatttggtagtgaccgggtgaagctgatggagagt
ctagtggttggagacattgcagagctaagaccaaaccagggtacactgtcattgtttacc
aacgaggctggaggcatcttagatgacttgattgtaaccaatacttctgaggggcacctg
tatgtggtgtccaacgctggctgctgggagaaagatttggccctcatgcaggacaaggtc
agggagcttcagaaccagggcagagatgtgggcctggaggtgttggataatgccctgcta
gctctgcaaggccccactgcagcccaggtactacaggccagcgtggcagatgacctgaag
aaactgcccttcatgactagtgctgtgatggaggtgtttggcgtgtctggctgccgtgtg
acccgctgtggctacacaggagaagacggtgtggagatctcggtgccggcagcaggggca
gttcacctggcaacagctcttctgaaaaacccagaggtgaagctggcagggctggcagcc
agggacagtctgcgcctggaggcaggcctctgcctttacgggaatgacattgatgaacac
actacacctgtggagggcagcctcagctggacactggggaagcgccgccaagctgctatg
gatttccctggagccaaggtcattgttccccaactgaagggcaaggtgcagcggaggcgt
gtggggttgatgtgtgagggggccccgatgcgggcacacagtcccatcctgaacatggag
ggtaccaagattggtaccgtgactagtggctgcccctcgccctctctgaagaagaatgtg
gcaatgggttatgtgccctgcgagtacagtcgtccagggacaatgctgctggtagaggtg
cggcggaagcagcagatggctgtagtcagcaagatgccctttgtgcccacaaactactat
accctcaagtga

DBGET integrated database retrieval system