KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108526993Help
Entry
108526993         CDS       T04641                                 

Gene name
GPX1
Definition
(RefSeq) glutathione peroxidase 1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00480  Glutathione metabolism
rbb00590  Arachidonic acid metabolism
rbb01100  Metabolic pathways
rbb04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    108526993 (GPX1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108526993 (GPX1)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    108526993 (GPX1)
Enzymes [BR:rbb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     108526993 (GPX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 108526993
NCBI-ProteinID: XP_017723573
Position
Un
AA seq 201 aa AA seqDB search
MCAAGLAAAAAQSVYAFSARPLAGGESVSLGSLRGKVLLIENVASLUGTTVRDYTQMNEL
QRRLGPRGLVVLGFPCNQFGHQENTKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGGGA
HPLFAFLREALPVPSDDATTLMTDPKFITWSPVCRNDVAWNFEKFLVGPDGVPVRRYSRR
FQTIDIEPDIEALLSQGPSSA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgctgctgggctagcggcggcagcggcccagtcggtgtacgccttctcggcgcgc
ccgctggccggcggggagtctgtgagcctgggctccctgcggggcaaggtgctacttatc
gagaatgtggcgtccctctgaggcaccacggtccgggactacacccagatgaacgagctg
cagcggcgccttgggccccggggcctggtggtgctcggcttcccgtgcaaccagtttggg
catcaggagaacaccaagaacgaagagattctgaattccctcaagtacgtccgacctggt
ggtgggttcgagcccaacttcatgctcttcgagaagtgcgaggtgaacggtgggggggcg
caccctctcttcgccttcctgcgggaggccctgccagtccccagcgacgatgccactacg
ctcatgaccgaccccaagttcatcacctggtctccggtgtgccgcaacgatgttgcctgg
aacttcgaaaagttcttggtgggccctgacggtgtgcccgtacgcaggtacagccgccgc
ttccagaccattgacatcgagcctgacatcgaagccctgctgtctcaaggtcccagcagt
gcctag

DBGET integrated database retrieval system