KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108530680Help
Entry
108530680         CDS       T04641                                 

Gene name
SEPT7
Definition
(RefSeq) septin 7
  KO
K16944  septin 7
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108530680 (SEPT7)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rbb04812]
    108530680 (SEPT7)
   04147 Exosome [BR:rbb04147]
    108530680 (SEPT7)
Membrane trafficking [BR:rbb04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    108530680 (SEPT7)
Cytoskeleton proteins [BR:rbb04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     108530680 (SEPT7)
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108530680 (SEPT7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase AIG1 Exonuc_VII_L AAA_22 AAA_16 Ras FeoB_N Fez1 ABC_tran AAA_29
Motif
Other DBs
NCBI-GeneID: 108530680
NCBI-ProteinID: XP_017729188
Position
Un
AA seq 478 aa AA seqDB search
MEASLRSARKPRLRGRGTEEGAGVGREPVEESVSCSVRKQGSDAGPLRRGIGVGAFGESA
GCAAPGLVAEGGRGCRSVRDPLLLRRGASTAAPWQQKNLEGYVGFANLPNQVYRKSVKRG
FEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLL
LTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPS
GHGLKPLDIEFMKHLHEKVSIIPFNAKADTLTPEECQQFTKQDRLPLAVVGSNTIIEVNG
KRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTY
NGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAEL
QRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQRILEQQNSSRTLEKNKKKGKIF
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggaagccagcctccgctcggcccggaagccccgtctgagggggcgggggacggaggag
ggagcgggagtcgggcgagagccagtagaggagtccgtctcctgtagcgtgcgtaagcag
ggcagcgacgccgggccgctacgccgcggaatcggcgtaggcgcctttggagaatcggcg
ggctgcgctgcgccggggctggtcgcggagggggggaggggatgtcggtcagtgcgagat
ccgctgctgctgaggagaggagcgtcaacagcagcaccatggcaacagaagaaccttgaa
ggctatgtgggatttgccaatctcccaaatcaagtatacagaaaatcagtgaagagaggt
tttgaattcacgcttatggtagtgggtgaatctggattgggaaagtcgacgttaatcaac
tcattattcctcacagatttgtattctccagagtatccaggtccttctcatagaattaaa
aagactgtacaggtggaacaatctaaagttttaatcaaagaaggtggtgttcagttgctg
ctcacaatagttgataccccaggatttggagatgcagtggataatagtaattgctggcag
cctgtcatcgactacattgatagtaaatttgaggactacttaaatgcagaatcacgagtg
aacagacgccagatgcctgataacagggtgcagtgttgtttatacttcattgctccttca
ggacatggacttaaaccattggatattgagtttatgaagcacttgcatgaaaaagtgagt
atcattccatttaatgccaaagcagacacactcacaccagaggaatgccaacagtttaca
aaacaggaccgtttacctcttgctgtggtaggtagtaatactatcattgaagttaatggc
aaaagggtcagaggaaggcagtatccttggggtgttgctgaagttgaaaatggtgaacat
tgtgattttacaatcctaagaaatatgttgataagaacacacatgcaggacttgaaagat
gttactaataatgtccactatgagaactacagaagcagaaaacttgcagctgtgacttac
aatggagttgataacaacaagaataaagggcagctgactaagagccctctggcacaaatg
gaagaagaaagaagggagcatgtagctaaaatgaagaagatggagatggagatggagcag
gtgtttgagatgaaggtcaaagaaaaagttcaaaagctgaaggactctgaagctgagctc
cagcggcgccatgaacaaatgaaaaagaatttggaagcacagcacaaagaattagaggaa
aaacgtcgtcagtttgaggatgagaaagcaaactgggaagctcaacaacgtattttagaa
caacagaactcttcgagaaccttggaaaagaacaagaagaaagggaagatcttttaa

DBGET integrated database retrieval system