KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108532009Help
Entry
108532009         CDS       T04641                                 

Gene name
MRPL22
Definition
(RefSeq) mitochondrial ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    108532009 (MRPL22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rbb03011]
    108532009 (MRPL22)
Ribosome [BR:rbb03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    108532009 (MRPL22)
  Bacteria
    108532009 (MRPL22)
  Archaea
    108532009 (MRPL22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 108532009
NCBI-ProteinID: XP_017731182
UniProt: A0A2K6KEL1
Position
Un
AA seq 206 aa AA seqDB search
MAAAVLGPLGALWKQNLRSQGKLALGVLPQSYIHTSASLDISRKWEKKNKIVYPPQLPGE
PRRPAEIYHCRRQIKYSKDKMWYLAKLIRGMSIDQALAQLEFNDKKGAKIIREVLLEAQD
MAVRDHNVEFRSNLYIAESTSGRGQCLKRIRYHGRGHFGIMEKVYCHYFVKLVEGPPPPP
EPPKTAVDHAKEYIQQLRNRTIIHTL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggtcctgggaccgttgggtgcgttatggaaacagaacctgaggagccag
gggaagctcgccttgggtgttttacctcaatcatatatccacacaagtgcttctcttgac
atttctcgaaaatgggagaagaagaataaaattgtttatcctccgcaactgcctggagaa
cctcggagaccagcagaaatctaccactgtcgaagacaaataaaatatagcaaagacaag
atgtggtatttggcaaaattgatacgaggaatgtctattgaccaggctttggctcagttg
gaattcaatgacaaaaaaggggccaaaataattagagaggttctcttagaagcacaagat
atggcagtgagagaccacaatgtggaattcaggtccaatttatatatagctgagtctacc
tcaggacgaggccagtgcctgaaacgcatccgctaccatggcagaggtcactttgggatc
atggagaaggtttattgccattattttgtgaagttggtggaagggcccccacctccacct
gagccaccaaagacagcagttgaccatgccaaagagtatattcagcagcttcgcaaccgg
actatcattcacactctgtga

DBGET integrated database retrieval system