KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108532991Help
Entry
108532991         CDS       T04641                                 

Definition
(RefSeq) aldo-keto reductase family 1 member C1 homolog
  KO
K00212  20alpha/3alpha-hydroxysteroid dehydrogenase / dihydrodiol dehydrogenase [EC:1.1.1.149 1.1.1.357 1.3.1.20]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00140  Steroid hormone biosynthesis
rbb00980  Metabolism of xenobiotics by cytochrome P450
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    108532991
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    108532991
Enzymes [BR:rbb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.149  20alpha-hydroxysteroid dehydrogenase
     108532991
    1.1.1.357  3alpha-hydroxysteroid 3-dehydrogenase
     108532991
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.20  trans-1,2-dihydrobenzene-1,2-diol dehydrogenase
     108532991
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-GeneID: 108532991
NCBI-ProteinID: XP_017732800
UniProt: A0A2K6MQZ8
Position
Un
AA seq 323 aa AA seqDB search
MDSKHQRVKLNDGHFMPVLGFGTYAPAEVPKDKALEATKLAIEVGFRHVDCAHIYNNEAQ
VGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPV
SVKPGEEMIPKDENGKVLFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKP
GLKYKPVCNQVECHPYLNQRKLLDFCKSKDIVLVAYSALGSHREEQWVDQNSPVLLKDPV
LCALAKKYKRTPALIALRYQLQRGVVVLAKSYNEQRIRENMKVFEFQLTSEDMKAIDDLD
RNIRYLTPVILADSPDYPFSDEY
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggattcgaaacatcagcgtgtgaagctgaatgatggtcacttcatgcccgtcctggga
tttggcacctatgcgcctgcagaggttcctaaagataaagctctagaggccaccaaactg
gcgatagaagttgggttccgccatgttgattgtgcacatatttataataatgaggcgcag
gttggactggccatccgaagcaagattgcagatggcagtgtgaagagagaagacatattc
tacacttcaaagctttggagcaattcccatcgaccagagttggtccgaccagccttggaa
aggtcactgaaaaatcttcaattggactatgttgacctctatcttattcattttccagtg
tctgtaaagccaggtgaggagatgatccccaaagatgaaaatgggaaagtactgtttgac
acagtggatctctgtgctacgtgggaggccatggagaaatgtaaagatgcaggattggcc
aagtccatcggggtgtccaacttcaaccgcaggcagctggaaatgatcctcaataagcca
gggctcaagtacaaacctgtctgcaaccaggtggaatgtcatccttacctcaaccagaga
aaactgctggatttctgcaagtcaaaagacattgttctggtggcctatagtgctctggga
tcccatcgagaagaacaatgggttgaccagaactccccggttctcttgaaggacccagtc
ctttgtgccttggcaaaaaagtacaagcgaaccccagccctgattgccctgcgctaccag
ctgcagcgtggcgttgtggtcctggccaagagctacaatgagcagcgaatcagggagaac
atgaaggtgtttgaattccagttgacttcagaggacatgaaagccatagatgacctagac
agaaatatacgatatttgacccctgttattttggctgactcccctgattatccattttct
gatgaatattaa

DBGET integrated database retrieval system