KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108534027
Entry
108534027         CDS       T04641                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00230  Purine metabolism
rbb00240  Pyrimidine metabolism
rbb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108534027 (DCK)
   00240 Pyrimidine metabolism
    108534027 (DCK)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     108534027 (DCK)
SSDB
Motif
Pfam: dNK Thymidylate_kin AAA_18 AAA_33 AAA_28 DUF932 CoaE
Other DBs
NCBI-GeneID: 108534027
NCBI-ProteinID: XP_017734594
UniProt: A0A2K6JSB7
Position
Un
AA seq 260 aa
MATPPKRSCPSLSASSEGTRIKKISIEGNIAAGKSTFVNILKQVCEDWEVVPEPVARWCN
VQSTQDEFEELTTSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAE
KPVLLFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLRA
TPEKCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTDFDYLQEVPILILDVNE
DFKDKHESLVEKVKEFLSTL
NT seq 783 nt   +upstreamnt  +downstreamnt
atggccaccccgcccaagagaagctgcccgtctctctcagccagctctgaggggacccgc
atcaagaaaatctccatcgaagggaacatcgctgcagggaagtcaacatttgtgaatatc
cttaaacaagtgtgtgaagattgggaagtggttcctgaacctgttgccagatggtgcaat
gttcaaagtactcaagatgaatttgaggaacttacaacgtctcagaaaaatggtgggaat
gttcttcagatgatgtatgagaaacctgaacgatggtcttttaccttccaaacatatgcc
tgtctcagtcgaataagagctcagcttgcctctctcaatggcaagctcaaagatgcagag
aaacctgtattactttttgaacgatctgtgtatagtgacaggtatatttttgcatctaat
ttgtatgaatctgaatgcatgaatgaaacagagtggacaatttatcaagactggcatgac
tggatgaataaccaatttggccaaagccttgaattggatggaatcatttatcttcgagcc
actccagagaaatgcttacatagaatatatttacggggaagaaatgaagagcaaggcatt
cctcttgaatatttagagaagcttcattataaacacgaaagctggctcctgcataggaca
ctgaaaaccgacttcgattatcttcaagaggtgcctatcttaatactggatgttaatgaa
gactttaaagacaaacatgaaagtctggttgaaaaggtcaaagaatttttgagtactttg
tga

DBGET integrated database retrieval system