KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108534105Help
Entry
108534105         CDS       T04641                                 

Gene name
PCYT2
Definition
(RefSeq) phosphate cytidylyltransferase 2, ethanolamine
  KO
K00967  ethanolamine-phosphate cytidylyltransferase [EC:2.7.7.14]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00440  Phosphonate and phosphinate metabolism
rbb00564  Glycerophospholipid metabolism
rbb01100  Metabolic pathways
Module
rbb_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    108534105 (PCYT2)
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    108534105 (PCYT2)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.14  ethanolamine-phosphate cytidylyltransferase
     108534105 (PCYT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like FAD_syn DUF218
Motif
Other DBs
NCBI-GeneID: 108534105
NCBI-ProteinID: XP_017734717
Position
Un
AA seq 415 aa AA seqDB search
MVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAIKWVDEVVPA
APYVTTLETLDKYNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGR
MLLVTKAHHSSQVSQGRNPQGPWVKVARGKEGHLPAPSGPSCPLLPIPTQSWGRHAWRAG
PSALLCPSVQEMSSEYREYADSFGKCPGGRNPWTGVSQFLQTSQKIIQFASGKEPQPGET
VIYVAGAFDLFHIGHVDFLEKVHRLAERPYIIAGLHFDQEVNHYKGKNYPIMNLHERTLS
VLACRYVSEVVIGAPYAVTAELLSHFKVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFCQI
DSGSNLTTDLIVQRIITNRLEYEARNQKKEAKELAFLEAARRQAAQPLGERDGDF
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggtgcattacggccactctaaccagctgcgccaggcacgggccatgggcgactacctc
atcgtaggcgtgcacactgatgaggagatcgccaagcacaaggggcccccggtgttcact
caggaggagagatacaagatggtgcaggccatcaaatgggtggacgaggtggtgcccgcc
gccccctacgtcactacgctagagaccctggacaaatacaactgtgacttctgtgttcac
ggcaatgacatcaccctgactgtagacggccgggacacctatgaggaggtaaagcaggcc
ggcaggtacagagagtgcaagcgcacacaaggggtgtccaccacagacctcgtgggccgc
atgctgctggtgaccaaagcccaccacagcagccaggtgagtcaagggcggaatccccaa
ggcccctgggtcaaggtcgccaggggaaaggaggggcacctccctgccccctcagggccc
tcctgcccactgctccccatccccacccagtcctggggtcgccacgcctggagggcaggc
ccctcagccctgctctgcccttctgtgcaggagatgtcttctgagtaccgggagtatgca
gacagttttggcaagtgccctggtgggcggaacccctggaccggggtatcccagttcctg
cagacatctcagaagatcatccagtttgcttccgggaaggagccccagccaggggagaca
gtcatctatgtggctggcgccttcgacctgttccacatcgggcatgtggacttcctggag
aaggtgcacaggctggcagagaggccctatatcatcgcaggcttacactttgaccaggag
gtcaatcactacaaggggaagaactaccccatcatgaatctgcacgagcgcaccttgagc
gtgttggcctgccggtacgtgtctgaagtggtgattggggccccgtatgcggtcacagca
gagctcctgagtcacttcaaggtggacctggtgtgtcacggcaagacggaaattatccct
gacagggacggctccgacccataccaggaacccaagagaaggggcatcttctgtcagatt
gacagtggcagcaacctcaccacggacctcatcgtgcagcggatcatcaccaacaggttg
gagtatgaggcacgaaaccagaagaaagaagccaaggagctggcctttctggaggccgcc
aggcggcaggcggcacagcccctgggggagcgcgatggcgacttctga

DBGET integrated database retrieval system