KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108534554Help
Entry
108534554         CDS       T04641                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04010  MAPK signaling pathway
rbb04014  Ras signaling pathway
rbb04015  Rap1 signaling pathway
rbb04022  cGMP-PKG signaling pathway
rbb04066  HIF-1 signaling pathway
rbb04068  FoxO signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04150  mTOR signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04152  AMPK signaling pathway
rbb04211  Longevity regulating pathway
rbb04213  Longevity regulating pathway - multiple species
rbb04520  Adherens junction
rbb04910  Insulin signaling pathway
rbb04913  Ovarian steroidogenesis
rbb04923  Regulation of lipolysis in adipocytes
rbb04930  Type II diabetes mellitus
rbb04931  Insulin resistance
rbb04932  Non-alcoholic fatty liver disease (NAFLD)
rbb04960  Aldosterone-regulated sodium reabsorption
Module
rbb_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    108534554 (INSR)
   04015 Rap1 signaling pathway
    108534554 (INSR)
   04010 MAPK signaling pathway
    108534554 (INSR)
   04066 HIF-1 signaling pathway
    108534554 (INSR)
   04068 FoxO signaling pathway
    108534554 (INSR)
   04072 Phospholipase D signaling pathway
    108534554 (INSR)
   04022 cGMP - PKG signaling pathway
    108534554 (INSR)
   04151 PI3K-Akt signaling pathway
    108534554 (INSR)
   04152 AMPK signaling pathway
    108534554 (INSR)
   04150 mTOR signaling pathway
    108534554 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    108534554 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    108534554 (INSR)
   04923 Regulation of lipolysis in adipocyte
    108534554 (INSR)
   04913 Ovarian Steroidogenesis
    108534554 (INSR)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    108534554 (INSR)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    108534554 (INSR)
   04213 Longevity regulating pathway - multiple species
    108534554 (INSR)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    108534554 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    108534554 (INSR)
   04931 Insulin resistance
    108534554 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108534554 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:rbb04090]
    108534554 (INSR)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     108534554 (INSR)
Protein kinases [BR:rbb01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   108534554 (INSR)
CD molecules [BR:rbb04090]
 Proteins
  108534554 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like B2 DUF4476
Motif
Other DBs
NCBI-GeneID: 108534554
NCBI-ProteinID: XP_017735491
Position
Un
AA seq 1385 aa AA seqDB search
MGTGGRRGTAAAPLLVAVAALLLGAAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHSECL
GNCSEPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHHKCKNSRRQG
CHQYVIHNNKCIPECPSGYTMNSSNLLCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGC
TVINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETL
EIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
RNDIALKTNGDQASCENELLKFSYIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFS
DERRTYGAKSDIIYVQTDATNPSVPLXPISVSNSSSQIILXWKPPSTPTATFNPLPVFWE
RQRKTAEAGRLFELRRCLSGLKLPSRTWSPPFESEDSQKHNQSEYEDSAGECCSCPKTDS
QILKELEESSFRKTFEDYLHNVVFVPRKTSSGTGAEDPRPSRKRRSLGDVGNVTAAVPTV
AAFPNTSSTSTPTSPEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDTPEERCSVA
AYVSARTMPEAKADDIVGPVTHEIFENNIVHLMWQEPKEPNGLIVLYEVSYRRYGDEELH
LCVSRKHFALERGCRLRGLSPGNYSVRVRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKI
IIGPLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWE
VPREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASV
MKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMI
QMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGL
LPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQ
PDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENKAPESEEL
EMEFEDMENVPLDRSSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLP
RSNPS
NT seq 4158 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccgggggccggcgggggacagctgccgcgccgctgctggtggcggtggccgcg
ctgctattgggcgccgcgggccacctgtaccccggagaggtgtgtcccggcatggatatc
cggaacaacctcaccaggttacacgagctggagaattgctctgtcatcgaaggacacttg
cagatactcttgatgttcaaaacgaggcccgaagatttccgagacctcagtttccccaaa
ctcataatgatcactgattacttgctgctcttccgggtctatgggcttgagagcctgaag
gacctgttccccaacctcacggtcatccggggatcacgactgttctttaactacgcgctg
gtcatcttcgagatggttcacctcaaggaactcggcctctacaacctaatgaacatcacc
cggggttctgtccgcattgagaagaacaacgagctctgttacttggccactatcgactgg
tcccgcatcctggattccgtggaggataattacatcgtgttgaacaaagatgacaacgag
gagtgcggagacatctgtccgggtacagcgaagggcaagaccaactgccccgccaccgtc
atcaatgggcagtttgtcgaacggtgttggactcatagtcactgccagaaagtttgccca
accatctgtaagtcacacggctgcactgccgaaggcctctgttgccacagcgagtgcctg
ggcaactgttctgagcccgacgaccccaccaagtgcgtggcctgccgcaacttctacctg
gacggcaggtgtgtggagacctgcccgcccccgtactaccacttccaggactggcgctgt
gtgaacttcagcttctgccaggacctgcaccacaaatgcaagaactcgcggaggcagggc
tgccaccagtacgtcattcataacaacaagtgcatccctgagtgtccctccgggtacacg
atgaattccagcaacttgctgtgcaccccgtgcctgggcccctgtcccaaggtatgccac
ctcctagaaggcgagaagaccatcgactcggtgacgtctgcccaggagctccgaggatgc
actgtcatcaacgggagtctgatcatcaacattcgaggaggcaataatctggcagctgag
ctagaagccaacctcggcctcattgaagaaatttcagggtatctaaaaatccgccgatcc
tacgctctggtgtcactttccttcttccggaagttacgtctgattcgaggagagaccttg
gaaatcgggaactactccttctatgccttggacaaccagaacctaaggcagctctgggat
tggagcaaacacaacctcaccatcactcaggggaaactcttcttccactataaccccaaa
ctctgcttgtcagaaatccacaagatggaagaagtttcaggaaccaaggggcgccaggag
agaaatgacattgccctgaagaccaatggggaccaggcatcctgtgaaaatgagttactt
aaattttcttacattcggacatctttcgataagatcttgctgagatgggagccgtactgg
ccccccgacttccgagacctcctggggttcatgctgttctacaaagaggccccttaccag
aatgtgacggagtttgacgggcaggatgcgtgtggttccaacagttggacggtggtagac
attgacccgcccctgaggtccaacgaccccaaatcacagaaccacccaggatggctaatg
cggggtctcaagccctggacccagtatgccatctttgtgaagaccctggtcaccttttcg
gatgaacgccggacctacggggccaagagtgacatcatttatgtccagacagatgctacc
aacccctccgtgcccctgncaccaatctcagtatctaactcatcatcccagattattttg
naatggaaacccccctcgaccccaacggcaacattcaacccactacctgttttctgggag
aggcagcggaagacagccgaggcgggcagattgtttgagctcaggagatgtctcagcggg
ctgaagctgccctctaggacctggtctccaccattcgagtctgaagattctcagaagcac
aaccagagtgaatatgaggattcagccggtgaatgttgctcgtgtccaaagacagactct
cagatcctgaaggagctggaggagtcctcgtttcggaagacgtttgaggattacctgcac
aacgtggttttcgtccccagaaaaacctcttcaggcactggtgccgaggaccctaggcca
tctcggaaacgcaggtcccttggcgatgttgggaatgtgacggcggccgtgcccacggtg
gcagctttccccaacacttcctcgaccagcacgcccacaagtccggaggagcacaggccc
tttgagaaggtggtgaacaaggagtcgctggtcatctccggcttgcgacacttcacgggc
tatcgcatcgagctgcaggcttgcaaccaagacacccctgaggaacggtgcagtgtggca
gcctacgtcagcgccaggaccatgcctgaagccaaggctgatgacattgttggccctgtg
acgcatgaaatctttgagaacaacatcgtccacttgatgtggcaggagccgaaggagccc
aatggtctgatcgtgctgtatgaagtgagttatcggcgatatggcgatgaggagctgcat
ctctgtgtctcccgcaagcacttcgctctggaacggggctgcaggctgcgcgggctgtct
ccagggaactacagcgtgcgagtccgggccacctccctcgcgggcaacggctcctggacg
gaacccacctatttctacgtcacagactatttagatgtcccgtcaaatattgcaaaaatt
atcatcggccccctcatctttgtctttctcttcagtgttgtgattggaagtatttatcta
ttcctgagaaagaggcagccagatgggccactgggaccgctttacgcttcttcaaaccct
gagtatctcagtgccagtgatgtgtttccatgctctgtgtacgtgccggacgagtgggag
gtgcctcgagagaagatcaccctccttcgagagctggggcagggctcctttggtatggtg
tatgagggcaacgccagggacatcatcaagggtgaggcagagacccgcgtggcagtgaag
acggtcaacgagtcagccagtctccgagagcggattgagttcctcaatgaggcctcggtc
atgaagggcttcacctgccatcatgtggtgcgcctcctgggagtggtgtccaagggccag
cccacgctggtggtgatggagctgatggctcacggagacctgaagagctacctccgttct
ctgcggccagaggctgagaataatcctggccgccctccccctaccctgcaagagatgatt
cagatggcagcggagattgctgatgggatggcctacctgaatgccaagaagtttgtgcat
cgggacctggcagcaagaaactgcatggtcgcccatgattttactgtcaaaattggagac
tttggaatgaccagagacatctatgaaactgattactaccggaaagggggcaagggtctg
ctccctgtacggtggatggcgccggagtccctgaaggatggggtctttaccacttcttct
gacatgtggtcctttggcgtggtcctttgggaaatcaccagcttggcagaacagccttac
caaggcctgtctaatgaacaggtgttgaaatttgtcatggacggagggtacctggatcaa
cctgacaactgtccagagagagtcactgacctcatgcgcatgtgctggcaattcaacccc
aagatgaggccaaccttcctggagattgtcaacctgctcaaagacgacctgcaccccagc
tttccggaggtgtccttctttcacagcgaggagaacaaggcccccgagagtgaggagctg
gagatggagtttgaggacatggagaatgtgccgctggaccgttcctcgcactgtcagagg
gaggaggcggggggccgggatggagggtcctcgctaggtttcaagcggagctacgaggaa
cacatcccttacactcacatgaacggaggcaagaaaaacgggcggatcctgaccttgcct
cggtccaatccttcctaa

DBGET integrated database retrieval system