KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108537521Help
Entry
108537521         CDS       T04641                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00561  Glycerolipid metabolism
rbb01100  Metabolic pathways
rbb04714  Thermogenesis
rbb04723  Retrograde endocannabinoid signaling
rbb04923  Regulation of lipolysis in adipocytes
Module
rbb_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    108537521 (MGLL)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    108537521 (MGLL)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    108537521 (MGLL)
  09159 Environmental adaptation
   04714 Thermogenesis
    108537521 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rbb01002]
    108537521 (MGLL)
Enzymes [BR:rbb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     108537521 (MGLL)
Peptidases [BR:rbb01002]
 Serine Peptidases
  Family S33
   108537521 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Esterase Lipase_3 Abhydrolase_3 DLH Abhydrolase_5 PGAP1 Thioesterase LIDHydrolase BAAT_C DUF1057 Abhydrolase_2 DUF1350 FSH1 DUF2974
Motif
Other DBs
NCBI-GeneID: 108537521
NCBI-ProteinID: XP_017740519
UniProt: A0A2K6ML11
Position
Un
AA seq 313 aa AA seqDB search
METGSEDPSRMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHG
AGEHCGRYEELAQMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKD
YPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLV
LPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVP
FLLLQGSADRLCDSKGAYLLMESAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWV
SQRTATAGTASPP
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaggatctgaagacccttccagaatgccagaggaaagttcccccaggcggacc
ccgcagagcattccctaccaggatctccctcacttggtcaatgcagacggacagtacctc
ttctgcaggtactggaaacccacgggcacacccaaggccctcatctttgtgtcccacgga
gccggagagcactgtggccgctatgaagagctggctcagatgctgatggggctggacctg
ctggtgttcgcccacgaccatgttggccacggacagagcgaaggggagaggatggtagtg
tctgacttccacgtttttgtcagagatgtgttgcagcatgtggattccatgcagaaagac
taccctgggcttcctgtcttccttctgggccactccatgggaggtgccatcgccatcctc
acggccgcagagaggccgggtcacttcgccggcatggtactcatttcacctctggttctt
gccaatcctgaatctgcaacaactttcaaggtccttgctgcgaaagtgctcaaccttgtg
ctgccaaacttgtccctcgggcccatcgactccagcgtgctctctcggaataagacagag
gtcgacatttataactcagaccccttgatctgccgggcagggctgaaggtgtgctttggc
atccagctgctgaatgccgtctcacgggtggagcgcgccctccccaagctgacggtgccc
ttcctgctgctccagggctctgctgatcgcctgtgtgacagcaaaggggcctacctgctc
atggagtcagccaagagccaggacaagactctcaagatttatgaaggtgcctaccacgtt
ctccacaaagagcttcctgaagtcaccaactctgtcttccatgaaataaacatgtgggtc
tctcaaaggacagccacggcaggaactgcgtccccaccctga

DBGET integrated database retrieval system