KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108538878Help
Entry
108538878         CDS       T04641                                 

Gene name
CACNG3
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit gamma 3
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04010  MAPK signaling pathway
rbb04260  Cardiac muscle contraction
rbb04261  Adrenergic signaling in cardiomyocytes
rbb04921  Oxytocin signaling pathway
rbb05410  Hypertrophic cardiomyopathy (HCM)
rbb05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
rbb05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108538878 (CACNG3)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    108538878 (CACNG3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    108538878 (CACNG3)
   04261 Adrenergic signaling in cardiomyocytes
    108538878 (CACNG3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    108538878 (CACNG3)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    108538878 (CACNG3)
   05414 Dilated cardiomyopathy (DCM)
    108538878 (CACNG3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rbb04040]
    108538878 (CACNG3)
Ion channels [BR:rbb04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   108538878 (CACNG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 ABC2_membrane_2
Motif
Other DBs
NCBI-GeneID: 108538878
NCBI-ProteinID: XP_017742699
UniProt: A0A2K6KV08
Position
Un
AA seq 315 aa AA seqDB search
MRMCDRGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTH
SGLWRTCCLEGAFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSVFPILSVTLLFFGGL
CVAASEFHRSRHNVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFY
FGAFSFIIAEIVGVVAVHIYIEKHQQLRAKSHSEFLKKSTFARLPPYRYRFRRRSSSRST
EPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKITMGTLLNSDRDHAFLQFHNSTPKEFK
ESLHNNPANRRTTPV
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgtgtgacagaggtatccagatgttgatcaccactgtgggagcctttgcagct
tttagtttaatgaccattgcagtgggcacggactactggttatattccagaggtgtgtgc
aggactaaatctacaagtgataatgaaaccagcaggaagaatgaagaagtaatgacccat
tcggggctgtggaggacgtgctgcctagaaggggctttccgaggtgtgtgcaagaaaatc
gatcacttccctgaagatgctgactacgaacaggacacagctgagtacctcctccgagct
gtgagggcctccagtgtcttccccatcctcagtgtcacgctgctgttcttcggcgggctc
tgcgtggcagccagcgagttccaccgcagcagacacaatgtcattctcagcgcgggcatc
ttttttgtctctgcagggttaagcaacatcattggcatcatagtttatatatcagccaac
gctggagaccccgggcagcgtgactccaaaaaaagttactcctatggttggtccttttat
ttcggagccttctctttcatcatcgcagaaatcgtaggagtggttgccgtgcacatctat
attgaaaaacatcagcagttacgagccaaatctcactcggagttcctgaagaaatctact
tttgcccgcctcccaccctacaggtatcgattccggaggcggtcaagttctcgctccacc
gagcccagatcccgagacctgtcccccatcagcaaaggcttccacaccatcccttccact
gacatctcgatgttcaccctctcccgggacccctcaaagatcaccatggggaccctcctc
aactccgaccgggaccacgcttttctacagttccacaattccacacccaaagagttcaaa
gagtcactgcataacaatccggccaacaggcgcaccacgcccgtctga

DBGET integrated database retrieval system