KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108539403Help
Entry
108539403         CDS       T04641                                 

Gene name
MAPK12
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01522  Endocrine resistance
rbb04010  MAPK signaling pathway
rbb04015  Rap1 signaling pathway
rbb04068  FoxO signaling pathway
rbb04071  Sphingolipid signaling pathway
rbb04218  Cellular senescence
rbb04261  Adrenergic signaling in cardiomyocytes
rbb04370  VEGF signaling pathway
rbb04380  Osteoclast differentiation
rbb04550  Signaling pathways regulating pluripotency of stem cells
rbb04611  Platelet activation
rbb04620  Toll-like receptor signaling pathway
rbb04621  NOD-like receptor signaling pathway
rbb04622  RIG-I-like receptor signaling pathway
rbb04625  C-type lectin receptor signaling pathway
rbb04657  IL-17 signaling pathway
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb04660  T cell receptor signaling pathway
rbb04664  Fc epsilon RI signaling pathway
rbb04668  TNF signaling pathway
rbb04670  Leukocyte transendothelial migration
rbb04714  Thermogenesis
rbb04722  Neurotrophin signaling pathway
rbb04723  Retrograde endocannabinoid signaling
rbb04728  Dopaminergic synapse
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04912  GnRH signaling pathway
rbb04914  Progesterone-mediated oocyte maturation
rbb04917  Prolactin signaling pathway
rbb04926  Relaxin signaling pathway
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb05014  Amyotrophic lateral sclerosis (ALS)
rbb05132  Salmonella infection
rbb05133  Pertussis
rbb05135  Yersinia infection
rbb05140  Leishmaniasis
rbb05142  Chagas disease (American trypanosomiasis)
rbb05145  Toxoplasmosis
rbb05152  Tuberculosis
rbb05161  Hepatitis B
rbb05163  Human cytomegalovirus infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05205  Proteoglycans in cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    108539403 (MAPK12)
   04010 MAPK signaling pathway
    108539403 (MAPK12)
   04370 VEGF signaling pathway
    108539403 (MAPK12)
   04668 TNF signaling pathway
    108539403 (MAPK12)
   04068 FoxO signaling pathway
    108539403 (MAPK12)
   04071 Sphingolipid signaling pathway
    108539403 (MAPK12)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    108539403 (MAPK12)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    108539403 (MAPK12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108539403 (MAPK12)
   04620 Toll-like receptor signaling pathway
    108539403 (MAPK12)
   04621 NOD-like receptor signaling pathway
    108539403 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    108539403 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    108539403 (MAPK12)
   04660 T cell receptor signaling pathway
    108539403 (MAPK12)
   04658 Th1 and Th2 cell differentiation
    108539403 (MAPK12)
   04659 Th17 cell differentiation
    108539403 (MAPK12)
   04657 IL-17 signaling pathway
    108539403 (MAPK12)
   04664 Fc epsilon RI signaling pathway
    108539403 (MAPK12)
   04670 Leukocyte transendothelial migration
    108539403 (MAPK12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    108539403 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    108539403 (MAPK12)
   04917 Prolactin signaling pathway
    108539403 (MAPK12)
   04926 Relaxin signaling pathway
    108539403 (MAPK12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108539403 (MAPK12)
  09156 Nervous system
   04728 Dopaminergic synapse
    108539403 (MAPK12)
   04723 Retrograde endocannabinoid signaling
    108539403 (MAPK12)
   04722 Neurotrophin signaling pathway
    108539403 (MAPK12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108539403 (MAPK12)
  09158 Development
   04380 Osteoclast differentiation
    108539403 (MAPK12)
  09159 Environmental adaptation
   04714 Thermogenesis
    108539403 (MAPK12)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    108539403 (MAPK12)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108539403 (MAPK12)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    108539403 (MAPK12)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108539403 (MAPK12)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108539403 (MAPK12)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108539403 (MAPK12)
   05135 Yersinia infection
    108539403 (MAPK12)
   05133 Pertussis
    108539403 (MAPK12)
   05152 Tuberculosis
    108539403 (MAPK12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108539403 (MAPK12)
   05161 Hepatitis B
    108539403 (MAPK12)
   05163 Human cytomegalovirus infection
    108539403 (MAPK12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108539403 (MAPK12)
   05169 Epstein-Barr virus infection
    108539403 (MAPK12)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108539403 (MAPK12)
   05140 Leishmaniasis
    108539403 (MAPK12)
   05142 Chagas disease (American trypanosomiasis)
    108539403 (MAPK12)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108539403 (MAPK12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108539403 (MAPK12)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     108539403 (MAPK12)
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   108539403 (MAPK12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr UvrD_C
Motif
Other DBs
NCBI-GeneID: 108539403
NCBI-ProteinID: XP_017743539
Position
Un
AA seq 419 aa AA seqDB search
MSSPPPARSGFYRRGGDARRPGRGGAAVYRDLQPLGRGQPHRRQGGHQEAVSALPVRAVR
QARLPRAAPAQTHASREQLLQASLGPCHPKMLRQQLSHDLSTVHLPNQGCCGDQVIGLLD
VFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGIIH
RVSPGGGASHQPSPSAIPCLHVLPDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVT
RWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAE
FVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAAEALAH
PYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETAL
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgagctctccgccgcctgcccgcagtggcttttaccgccgaggaggtgacgcaagacgg
cctgggaggggtggcgcggccgtgtaccgggacctgcagccgctcggccgtggacagccg
caccggcgccaaggtggccatcaagaagctgtatcggcccttccagtccgagctgttcgc
caagcgcgcctaccgcgagctgcgcctgctcaaacacatgcgtcacgagaacaactcctc
caggcctccctgggaccctgtcaccccaaaatgctgaggcagcagttatcacatgaccta
tccactgtccatctccccaaccaggggtgctgtggggaccaggtgattgggctgctggac
gtattcactcctgatgagaccctggatgacttcacagacttttacctggtgatgccattc
atgggcaccgacctgggcaagctcatgaaacatgagaagctgggcgaggaccggatccag
ttcctcgtgtaccagatgctgaaggggttgaggtatatccatgctgccggcatcatccac
agagtgagtcctggtggaggagccagccatcagccctcccccagcgcaatcccctgcctc
cacgtcctacctgacctgaagcctggcaacctggctgtgaacgaagactgtgagctgaag
atcctggactttggcctggccaggcaagcagacagtgagatgactgggtatgtggtgacc
cggtggtaccgggcacccgaggtcatcttgaattggatgcgctacacgcagacggtggac
atctggtctgtgggctgcatcatggcggagatgatcacaggcaagacgctgttcaagggc
agcgaccacctggaccagctgaaggagatcatgaaggtgacagggacgcctccagctgag
tttgtgcagcggctgcagagtgatgaggccaagaactacatgaagggcctccccgagttg
gagaagaaggattttgcctccatcctgaccaatgcaagccctctggctgtgaacctcctg
gagaagatgctggtgctggatgcggagcagcgggtgacagcagccgaggcactggcccat
ccctacttcgagtccctgcacgacacagaagatgagccccaggtccagaagtatgacgac
tcctttgatgacgtggaccgcacgctggatgaatggaagcgtgttacttacaaagaggtg
ctcagcttcaagcctccccggcagctgggagccagggtctccaaggagacggctctgtga

DBGET integrated database retrieval system