KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108539783Help
Entry
108539783         CDS       T04641                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase A
  KO
K03767  peptidyl-prolyl cis-trans isomerase A (cyclophilin A) [EC:5.2.1.8]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108539783
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rbb03110]
    108539783
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108539783
Enzymes [BR:rbb01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     108539783
Chaperones and folding catalysts [BR:rbb03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    108539783
Exosome [BR:rbb04147]
 Exosomal proteins
  Proteins found in most exosomes
   108539783
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 108539783
NCBI-ProteinID: XP_017744169
UniProt: A0A2K6LJW7
Position
Un
AA seq 165 aa AA seqDB search
MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGF
MCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTE
WLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaccctaccgtgttcttcgacattgccgtcgacggcgagcccttgggccgcgtc
tccttcgagctgtttgcagacaaggttccaaagacagcagaaaattttcgtgctctgagc
actggagagaaaggatttggttataagggttcctgctttcacagaattattccagggttt
atgtgtcagggtggtgacttcacacgccataatggcactggtggcaagtccatctatggg
gagaaatttgaagatgagaacttcatcctaaagcatacaggtcctggcatcttgtccatg
gcaaatgctggacccaacacaaatggttcccagtttttcatctgcactgccaagactgag
tggttggatggcaagcatgtggtctttggcaaagtgaaagaaggcatgaatattgtggag
gccatggagcgctttgggtccaggaatggcaagaccagcaagaagatcaccattgctgac
tgtggacaactcgaataa

DBGET integrated database retrieval system