KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108539989Help
Entry
108539989         CDS       T04641                                 

Gene name
IRAK4
Definition
(RefSeq) interleukin 1 receptor associated kinase 4
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04010  MAPK signaling pathway
rbb04064  NF-kappa B signaling pathway
rbb04620  Toll-like receptor signaling pathway
rbb04621  NOD-like receptor signaling pathway
rbb04722  Neurotrophin signaling pathway
rbb05133  Pertussis
rbb05135  Yersinia infection
rbb05140  Leishmaniasis
rbb05142  Chagas disease (American trypanosomiasis)
rbb05145  Toxoplasmosis
rbb05152  Tuberculosis
rbb05161  Hepatitis B
rbb05162  Measles
rbb05164  Influenza A
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108539989 (IRAK4)
   04064 NF-kappa B signaling pathway
    108539989 (IRAK4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108539989 (IRAK4)
   04621 NOD-like receptor signaling pathway
    108539989 (IRAK4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    108539989 (IRAK4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108539989 (IRAK4)
   05133 Pertussis
    108539989 (IRAK4)
   05152 Tuberculosis
    108539989 (IRAK4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108539989 (IRAK4)
   05162 Measles
    108539989 (IRAK4)
   05164 Influenza A
    108539989 (IRAK4)
   05161 Hepatitis B
    108539989 (IRAK4)
   05168 Herpes simplex virus 1 infection
    108539989 (IRAK4)
   05169 Epstein-Barr virus infection
    108539989 (IRAK4)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108539989 (IRAK4)
   05140 Leishmaniasis
    108539989 (IRAK4)
   05142 Chagas disease (American trypanosomiasis)
    108539989 (IRAK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108539989 (IRAK4)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108539989 (IRAK4)
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: TKL group
  IRAK family
   108539989 (IRAK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Pkinase_fungal Haspin_kinase Death Focal_AT
Motif
Other DBs
NCBI-GeneID: 108539989
NCBI-ProteinID: XP_017744448
UniProt: A0A2K6MSR5
Position
Un
AA seq 461 aa AA seqDB search
MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALL
QTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAVTV
QQKQMPFYDKDRTLMTPLQNLEQSYMPPDSSSPENKSLEVSDTRKFSQFSFYELKNVTNN
FDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAK
CQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGI
NFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEA
LRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMN
DADSTSIEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacccataacaccgtcaacatatgtgcgctgcctcaatgttggactgattagg
aagctgtcagattttattgatcctcaagaaggatggaagaagttagctgtagctattaaa
aaaccatctggtgatgatagatacaatcagtttcacataaggagatttgaagcattactt
caaactggaaaaagtcccacttctgaattactgtttgactggggcaccacaaattgcaca
gttggtgatcttgtggatcttttaatccaaaatgaattttttgctcctgcgagtcttttg
ctcccagatgctgttcccaaaactgctaatacactaccttctaaagaagctgtaacagtt
caacaaaaacagatgcctttctatgacaaagacaggacattgatgacacctctgcagaat
cttgaacaaagctatatgccacctgactcctcaagtccagaaaataaaagtttagaagtt
agtgatacacgtaagttttcacagttttcattttatgaattgaagaacgtcacaaataac
tttgatgaacgacccatttctgttggtggtaataaaatgggagagggaggatttggagtt
gtatataaaggctacgtaaataacacaactgtggcagtaaagaagcttgcagcaatggtt
gacattactactgaagaactgaaacagcagtttgatcaagaaataaaagtaatggcaaag
tgtcaacatgaaaacttagtagaactacttggtttctcaagtgatggagatgacctctgc
ttagtgtatgtttacatgcctaatggttcattactagacagactctcttgcttggatggt
actccaccactttcttggcacatgagatgcaagattgctcagggtgcagctaatggcatc
aattttctacatgaaaatcatcatattcatagagatattaaaagtgcaaatatcttacta
gatgaagcttttactgctaaaatatctgactttggccttgcacgggcttctgagaagttt
gcccagacagtcatgactagcagaattgtgggaacaacagcttatatggcacctgaagct
ttgcgaggagaaataacacccaaatctgacatttacagctttggtgtggttttactagaa
ataataactggacttccagccgtggatgaacaccgtgaacctcagttattgctagatatt
aaagaagaaattgaagatgaagaaaagacgattgaagattatattgataaaaagatgaat
gatgctgattccacttcaattgaagctatgtactctgttgctagtcaatgtctgcatgaa
aagaaaaataagagaccagacattaagaaggttcaacagctgctgcaagagatgacagct
tcttaa

DBGET integrated database retrieval system