KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108540352Help
Entry
108540352         CDS       T04641                                 

Gene name
IDH1
Definition
(RefSeq) isocitrate dehydrogenase (NADP(+)) 1, cytosolic
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00020  Citrate cycle (TCA cycle)
rbb00480  Glutathione metabolism
rbb01100  Metabolic pathways
rbb01200  Carbon metabolism
rbb01210  2-Oxocarboxylic acid metabolism
rbb01230  Biosynthesis of amino acids
rbb04146  Peroxisome
Module
rbb_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    108540352 (IDH1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108540352 (IDH1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    108540352 (IDH1)
Enzymes [BR:rbb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     108540352 (IDH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 108540352
NCBI-ProteinID: XP_017744869
UniProt: A0A2K6KHW3
Position
Un
AA seq 414 aa AA seqDB search
MSKKISGGSVVELQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDA
AEAIKKYNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRL
VSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAM
GMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFE
AQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDG
KTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALE
EVCIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaaaaatcagtggcggttctgtggtagagctgcaaggagatgaaatgacacga
atcatttgggaattgattaaagagaaactcatttttccctatgtggaattggatctacat
agctatgatttaggcatagagaatcgtgatgccaccaacgaccaggtcaccaaggatgct
gcagaagctataaagaagtataatgttggtgtcaagtgtgccactatcactcctgatgag
aagagggttgaggagttcaagttgaaacaaatgtggaaatcaccaaatggcaccatacga
aatattctgggtggcacagtcttcagagaagccattatctgcaaaaatatcccccggctt
gtgagtggatgggtaaaacctatcatcataggtcgtcatgcttacggggatcaatacaga
gcaactgattttgttgttcctggccctggaaaagtagagataacctacacaccaagtgac
ggaacccaaaaggtgacatacctggtacataactttgaagagggtggtggtgttgccatg
gggatgtataatcaagataagtcaattgaagattttgcacacagttccttccaaatggct
ctgtctaagggttggcctttgtatctgagcaccaaaaacactattctgaagaaatatgat
gggcgttttaaagacatctttcaggagatatatgacaagcagtacaagtcccaatttgaa
gcccaaaagatctggtatgagcataggctcattgatgacatggtggcccaagctatgaaa
tcagagggaggcttcatctgggcctgtaaaaactatgatggtgacgtgcagtcggactct
gtggcccaagggtatggctctctcggcatgatgaccagtgtgctggtttgtccagatggc
aagacagtagaagcagaggctgcccacgggactgtaacccgtcactaccgcatgtaccag
aaaggacaggagacgtccaccaatcccattgcatccatttttgcctggaccagagggtta
gcccatagagcaaagcttgataacaataaagaacttgccttctttgcaaatgctttggaa
gaagtctgtattgagacaattgaggctggcttcatgaccaaggacttggccgcttgcatt
aaaggtttacccaatgtgcaacgttctgactacttgaatacatttgagttcatggacaaa
cttggagaaaacttgaagatcaaactagctcaggccaaactttaa

DBGET integrated database retrieval system