KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108540946
Entry
108540946         CDS       T04641                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00230  Purine metabolism
rbb01100  Metabolic pathways
rbb01522  Endocrine resistance
rbb04015  Rap1 signaling pathway
rbb04020  Calcium signaling pathway
rbb04022  cGMP-PKG signaling pathway
rbb04024  cAMP signaling pathway
rbb04062  Chemokine signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04114  Oocyte meiosis
rbb04211  Longevity regulating pathway
rbb04213  Longevity regulating pathway - multiple species
rbb04261  Adrenergic signaling in cardiomyocytes
rbb04270  Vascular smooth muscle contraction
rbb04371  Apelin signaling pathway
rbb04540  Gap junction
rbb04611  Platelet activation
rbb04713  Circadian entrainment
rbb04714  Thermogenesis
rbb04723  Retrograde endocannabinoid signaling
rbb04724  Glutamatergic synapse
rbb04725  Cholinergic synapse
rbb04727  GABAergic synapse
rbb04742  Taste transduction
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04911  Insulin secretion
rbb04912  GnRH signaling pathway
rbb04913  Ovarian steroidogenesis
rbb04914  Progesterone-mediated oocyte maturation
rbb04915  Estrogen signaling pathway
rbb04916  Melanogenesis
rbb04918  Thyroid hormone synthesis
rbb04921  Oxytocin signaling pathway
rbb04923  Regulation of lipolysis in adipocytes
rbb04925  Aldosterone synthesis and secretion
rbb04926  Relaxin signaling pathway
rbb04927  Cortisol synthesis and secretion
rbb04928  Parathyroid hormone synthesis, secretion and action
rbb04934  Cushing syndrome
rbb04935  Growth hormone synthesis, secretion and action
rbb04970  Salivary secretion
rbb04971  Gastric acid secretion
rbb04972  Pancreatic secretion
rbb04976  Bile secretion
rbb05032  Morphine addiction
rbb05163  Human cytomegalovirus infection
rbb05166  Human T-cell leukemia virus 1 infection
rbb05200  Pathways in cancer
rbb05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108540946 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    108540946 (ADCY4)
   04371 Apelin signaling pathway
    108540946 (ADCY4)
   04020 Calcium signaling pathway
    108540946 (ADCY4)
   04072 Phospholipase D signaling pathway
    108540946 (ADCY4)
   04024 cAMP signaling pathway
    108540946 (ADCY4)
   04022 cGMP-PKG signaling pathway
    108540946 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108540946 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    108540946 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108540946 (ADCY4)
   04062 Chemokine signaling pathway
    108540946 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    108540946 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    108540946 (ADCY4)
   04912 GnRH signaling pathway
    108540946 (ADCY4)
   04913 Ovarian steroidogenesis
    108540946 (ADCY4)
   04915 Estrogen signaling pathway
    108540946 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    108540946 (ADCY4)
   04921 Oxytocin signaling pathway
    108540946 (ADCY4)
   04926 Relaxin signaling pathway
    108540946 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    108540946 (ADCY4)
   04918 Thyroid hormone synthesis
    108540946 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    108540946 (ADCY4)
   04916 Melanogenesis
    108540946 (ADCY4)
   04925 Aldosterone synthesis and secretion
    108540946 (ADCY4)
   04927 Cortisol synthesis and secretion
    108540946 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108540946 (ADCY4)
   04270 Vascular smooth muscle contraction
    108540946 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    108540946 (ADCY4)
   04971 Gastric acid secretion
    108540946 (ADCY4)
   04972 Pancreatic secretion
    108540946 (ADCY4)
   04976 Bile secretion
    108540946 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    108540946 (ADCY4)
   04727 GABAergic synapse
    108540946 (ADCY4)
   04725 Cholinergic synapse
    108540946 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    108540946 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    108540946 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    108540946 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    108540946 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    108540946 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108540946 (ADCY4)
   04714 Thermogenesis
    108540946 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108540946 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    108540946 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    108540946 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108540946 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108540946 (ADCY4)
   05163 Human cytomegalovirus infection
    108540946 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108540946 (ADCY4)
Enzymes [BR:rbb01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     108540946 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N DUF3180 CD52
Other DBs
NCBI-GeneID: 108540946
NCBI-ProteinID: XP_017745742
Position
Un
AA seq 1190 aa
MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLGIVLCALAALLAVAWASGRELTSDPS
FLTTVLCALGGFSLLLGLASREQRLQRWTRPLSGLVWVALLALGHAFLFTGGVVSAWDQV
SYFLFVIFTVYAMLPLGMRDAAVAGLASSLSHLLVLGLYLGPQPDSRPALLPQLAANAVL
FLCGNVAGVYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
AYAVEDAGMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGPKMRPSLLMTR
YLESWGAAKPFAHLSHVDSPVSTSTPLQEKTLASFSPQWSLDRSRNPRGLDDELDTGDAK
FFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSAIPAFKYYEACTFLVFLSNFI
IQMLVTNRPPALAITYSITFLLFLLLLFVCFSEDLMRCALKGPKMLHWLPALSGLVATRP
GLRIALSTATILLVFAMATTSLDLDSFLEFYSWRAPGNHPSAKLQKRKLRPREAKWLARA
HTVAQSQRSTLDAPHITPPPVRTPVLRFPSLPEIAESTPLDESGPDSSLGQLKPSTSHHC
AQETTCLFSSSSPLQFFFPTSSDCPFQAPNVSSMISNLSWELPGSLPLISVPYSMHCCTL
GFLSCSLFLHMSFELKLLLLLLWLAASCSLFLHSHAWLSDCLIVRLYLGPLDSRPGVLKE
PKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRLLLENVLP
AHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLRLLNEIIA
DFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHLGTMVEFAVALG
SKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMESTGVLGKIQ
VTEETAWALQSLGYTCYSRGVIKVKGKGQLCTYFLNTDLTRSGPPSVTLG
NT seq 3573 nt   +upstreamnt  +downstreamnt
atggcccgcctcttcagcccccggccaccccccagcgaagacctcttctacgagacctac
tacagcctgagccagcagtacccgctgctgctgctgctgctggggatcgtgctctgtgcg
ctcgcggcgctgctcgcggttgcctgggccagcggcagggagctgacttcagacccgagc
ttcctgaccactgtgctgtgcgcgctgggcggcttctcgctgctgctgggcctcgcttcc
cgcgagcagcgactgcagcgctggacgcgtcctctgtccggcttggtgtgggtcgcgctg
ctagcgctaggccacgccttcctgttcaccgggggcgtggtgagcgcctgggaccaggtg
tcctattttctcttcgtcatcttcacggtgtatgccatgctgcccttgggcatgcgggac
gccgccgtcgcgggcctcgcctcctcactctcgcatctactggtcctggggctgtatctt
gggccacagccggactcacggcctgcactgctgccgcagttggcagcaaatgcggtgctg
ttcctgtgcgggaacgtggcaggagtgtaccacaaggcgctgatggagcgcgccctgcgg
gccacgttccgggaggcactcagctccttgcactcgcgccggcggctggacaccgaaaag
aagcaccaggaacaccttctcttgtccatccttcctgcctacctggcccgagagatgaaa
gcagagatcatggcacggctgcaggcaggacaggggtcacggccagaaagcaccaacaat
ttccacagcctctatgtcaagaggcaccagggagtcagtgtgctgtatgctgacattgtg
ggcttcacgcggctggccagcgagtgttcccctaaggagctggtgctcatgctcaatgag
ctctttggcaagtttgaccagatcgccaaggagcatgaatgcatgcggatcaagatcctg
ggggactgttactactgtgtctccggactgccactctcactgccagaccatgccatcaac
tgtgtgcgcatggggctggacatgtgccgggccatcaggaaactgcgggcagccactggc
gtggacatcaacatgcgtgtgggcgtgcactcaggcagtgtactctgtggagtcatcggg
ctgcagaagtggcagtatgacgtttggtcccatgatgttacactggctaaccacatggag
gcaggcggtgtaccagggcgagtgcacatcacaggggctaccctggccctgctggcaggg
gcttatgctgtggaggacgcaggcatggagcatcgggatccctaccttcgggagctaggg
gagcccacttatctggtcattgatccacgggcagaggaggaggatgagaagggcactgca
ggaggcttgctctcctcgcttgagggccccaagatgcgtccatcactgctgatgacccgt
tacctggagtcctggggtgcagccaagccttttgcccacctgagccacgtagacagccct
gtgtccacctccacccctctccaggagaagaccctggcttccttcagcccccagtggagc
ctagatcgaagccgtaacccccgtggactagatgatgaactggacaccggggatgccaag
ttcttccaggtcattgagcagctcaactcacagaaacagtggaagcagtcgaaggacttc
aacccactgacactgtacttcagagagaaggagatggagaaagagtaccgactctctgca
atccccgccttcaaatactatgaagcctgcaccttcctggtttttctctccaacttcatc
atccagatgctagtgacaaacaggcccccagctctggccatcacgtatagcatcaccttc
ctcctcttcctcctcctcctttttgtctgcttctcagaggacctgatgaggtgtgccctg
aaaggccccaagatgctgcattggctgcctgcactgtctggcttggtggccacacgacca
ggactgagaatagccttgagcaccgccaccatcctccttgtctttgccatggccactacc
agcctggatttagactcattcctagaattctattcctggagggcacctgggaatcaccca
tcagccaagttacagaagaggaagctaaggcccagagaggctaagtggctggcaagagct
cacacagtggctcagagtcagagaagtactcttgatgcccctcacataactcctccccca
gtgaggaccccagtgctgaggttcccttccctaccagaaatagcagaatccacccctttg
gacgagtctggccctgactcatctctgggtcagctgaaacccagcacaagccaccattgt
gcccaagaaactacctgcctcttcagctcctcatctcctctgcagttcttcttcccaaca
tcatcagactgccctttccaagctcccaatgtgtcctccatgatttccaacctctcctgg
gagctccctgggtctctgcctctcatcagtgtcccatactccatgcactgctgcacgctg
ggcttcctctcctgctccctctttctgcacatgagcttcgagctgaagctgctgctgctc
ctgctgtggctggcggcatcctgctccctcttcctacactcccacgcctggctgtccgac
tgcctcatcgtccgcctctatctgggccccttggactccaggcccggagtgctgaaggag
cccaaactcatgggtgctatctccttcttcatcttcttcttcaccctccttgtcctggct
cgccagaatgagtactactgccgcctggacttcctgtggaagaagaagctgaggcaggag
cgggaggagacagagacgatggagaacctgactcggctgctcttggagaatgtgctccct
gcacacgtggccccccagttcattggccagaaccggcgcaacgaggatctctaccaccag
tcctacgaatgcgtttgtgtcctcttcgcttcagtcccagacttcaaggagttctactct
gaatccaacatcaatcatgagggcctagagtgtctgaggctgctcaatgaaataattgct
gattttgatgagctgctctccaagcccaagttcagtggggtggagaagatcaagaccatt
ggcagcacctacatggcagccacaggattaaatgccacctctggacaggatgcacaacag
gatgctgaacggagctgcagccaccttggcactatggtggaatttgccgttgccctgggg
tctaagctggacgtcatcaacaagcattcattcaacaacttccgcctgcgtgtggggttg
aaccatggaccagtagtagctggagttattggggcccagaagccacaatatgacatttgg
ggcaacacagtgaacgtggccagccgcatggagagtacaggagtccttggcaaaatccaa
gtgactgaggagacagcctgggccctacagtccctgggctacacctgctacagccggggg
gtcatcaaggtgaaaggcaaagggcagctctgcacctacttcctgaacacagacttgaca
cgaagtggacctccttcagttaccctaggctga

DBGET integrated database retrieval system