KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108542816Help
Entry
108542816         CDS       T04641                                 

Gene name
SUCLG1
Definition
(RefSeq) succinate-CoA ligase alpha subunit
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00020  Citrate cycle (TCA cycle)
rbb00640  Propanoate metabolism
rbb01100  Metabolic pathways
rbb01200  Carbon metabolism
Module
rbb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rbb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    108542816 (SUCLG1)
   00640 Propanoate metabolism
    108542816 (SUCLG1)
Enzymes [BR:rbb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     108542816 (SUCLG1)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     108542816 (SUCLG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 108542816
NCBI-ProteinID: XP_017748466
Position
Un
AA seq 348 aa AA seqDB search
MTATLAAAADIATMVFGSSGLAATRLLSRSFLRELAQNGIRHCSYTASRKHLYVDKNTKI
ICQGFTGKQGTFHSQQALEYGTKLVGGTTPGKGGQTHLGLPVFNTVKEAKEQTGATASVI
YVPPPFAAAAINEAVEAEIPLVVCITEGIPQQDMVRVKHKLLRQGKTRLIGPNCPGVINP
GECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTEVGLGQSLCVGIGGDPFNGTDFID
CLEIFLNDSATEGIILIGEIGGNAEENAAEFXKQHNSGPNSKPVVSFIAGLTAPPGRRMG
HAGAIIAGGKGGAKEKISALQSAGVVVSMSPAQLGTTIYKEFEKRKML
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgacccttgcggctgcggctgacatcgctaccatggtcttcggcagcagcggt
ctcgcagccacccgtctgctgtcgcgcagcttcctccgtgagttggcacagaatggaatt
cggcattgttcctatacagcttctcggaaacatctgtatgttgataaaaatacaaagatt
atttgccagggtttcactggcaaacagggcacctttcacagccagcaggcattggaatat
ggcaccaaactcgttggaggaaccactccggggaaaggaggccagacgcatctgggctta
cctgtctttaatactgtgaaggaggccaaagaacagacaggagcaacggcttctgtcatt
tatgttcctccgccctttgctgccgctgccattaatgaagctgttgaggcggaaattccc
ttggttgtgtgtatcactgaaggaattccccagcaggacatggtacgagtcaagcacaaa
ctgctgcgccagggaaagacaaggctaattgggcccaactgccctggagtcatcaatcct
ggagaatgtaaaattggcatcatgcctggccatattcacaaaaaaggaaggattggcatt
gtgtccagatccggcaccctgacttatgaagcagttcaccagacaacggaagttggattg
gggcagtctttgtgtgttggcattggaggcgatccttttaatggaacagattttattgac
tgcctcgaaatctttttgaatgattctgccacagaaggcatcatattgattggtgaaatt
ggtggtaatgcagaagagaatgctgcagaatttntgaagcaacataattcaggtccaaat
tccaagcctgtagtgtccttcattgctgggttaactgctcctcctgggaggagaatgggt
catgccggggcaattattgccggaggaaaaggtggagctaaagagaagatctccgctctt
cagagtgcaggagttgtggtcagtatgtctcctgcacagctgggaaccacgatctacaag
gaatttgaaaagaggaagatgctgtga

DBGET integrated database retrieval system