KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108543165
Entry
108543165         CDS       T04641                                 

Gene name
TM7SF2
Definition
(RefSeq) transmembrane 7 superfamily member 2
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00100  Steroid biosynthesis
rbb01100  Metabolic pathways
Module
rbb_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    108543165 (TM7SF2)
Enzymes [BR:rbb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     108543165 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 108543165
NCBI-ProteinID: XP_017748974
Position
Un
AA seq 482 aa
MGRGRVHLKTLGQERSLSALGVQAGAGAAGPVPPRGRVHLLGNGADSVSLIDSCERPLSG
GAETMAPPQGPRAPLEFGGPLGAAALLLLLPATMFHLLLAARSGPARLLGPPASLPGLEA
LWSPRALLLWLAWLGLQAALYLLPARKVAEGQELKDKSRLRYPINGFQALVLTALLVGLG
VSAGLPLGALPEMLLPLAFVATLTAFIFSLFLYMKAQVAPVSALAPGGNSGNPIYDFFLG
RELNPRICFFDFKYFCELRPGLIGWVLINLALLVKEAELRGSPSLAMWLVNGFQLLYVGD
ALWHEEAVLTTMDITHDGFGFMLAFGDIAWVPFTYSLQAQFLLRHPQPLGLPMASAICLI
NAIGYYIFRGANSQKNTFRKNPSDPRVAGLETISTATGRKLLVSGWWGMVRHPNYLGDLI
MALAWSLPCGVSHLLPYFYLLYFTALLVHREARDERQCLQKYGLAWQEYCRRVPYRIMPY
IY
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgggcagggggcgggtccacttaaaaaccctgggacaagagcggtccttgtctgcactc
ggtgttcaggcaggtgcaggcgccgcagggccggttcctccgcgcggccgagtccatctc
ctgggaaatggggcggacagtgtttccttgatcgacagttgtgagcgccctctctccggc
ggagcggagaccatggccccccctcagggcccccgggccccgctggaattcggagggccc
ctgggcgccgcggctctgctgctgctgctgcccgccaccatgttccacctgctcctggca
gcccgttcgggccccgcgcgcctgctgggtccacccgcgtccctgcctgggctggaggcg
ctgtggagcccacgggcgctgctgctgtggctcgcctggctcggcctgcaggcggcgctc
tacctactgccggcgcgcaaggtggctgaggggcaggaattgaaggacaagagtcgcctg
cgctatcccattaacggcttccaggccctggtgctgacagccctgttggtggggctggga
gtgtcagcggggctgcctctgggggcgctcccggagatgctcctgcccttggcttttgtc
gccaccctcaccgctttcatcttcagcctctttctctacatgaaggcgcaggtagcccca
gtttcggccctggcacctggggggaactcaggcaatccgatttacgacttttttctggga
cgggagctcaaccctcgtatctgtttcttcgacttcaaatatttctgtgaactgcgacct
ggcctcattggctgggtcctcatcaacctggccctgttggtgaaggaggcagaacttcgg
ggcagtccctcactggccatgtggctggtcaatggcttccagttactctatgtgggtgat
gccctctggcacgaggaggccgtcctcaccaccatggatatcacacatgacgggtttggc
ttcatgctggcatttggggacatagcctgggtgcccttcacctacagcctgcaggcccag
ttcctgctgcgccacccgcagcctctggggttgcccatggcttctgccatctgcctcatc
aatgctattggttactacatcttccgtggggcgaattcccagaaaaacactttccgaaag
aatccttctgaccccagagtggctgggcttgagaccatctctacagccacagggcggaaa
ctgctggtgtctgggtggtggggtatggtccgccatcccaactatcttggagacctcatc
atggctctggcttggtccttgccctgtggggtgtcacacctgctgccctacttctacctc
ctctacttcaccgcgctgctggtgcaccgtgaggcccgggatgagcggcagtgcctgcag
aagtacggcctggcctggcaggagtactgccggcgtgtgccttaccgtatcatgccctac
atctactga

DBGET integrated database retrieval system