KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108543611Help
Entry
108543611         CDS       T04641                                 

Gene name
ABHD6
Definition
(RefSeq) abhydrolase domain containing 6
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04723  Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    108543611 (ABHD6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rbb01002]
    108543611 (ABHD6)
Enzymes [BR:rbb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     108543611 (ABHD6)
Peptidases [BR:rbb01002]
 Serine Peptidases
  Family S33
   108543611 (ABHD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr BAAT_C FSH1 DUF1057 DLH C9orf72-like Thioesterase
Motif
Other DBs
NCBI-GeneID: 108543611
NCBI-ProteinID: XP_017749668
UniProt: A0A2K6LAK7
Position
Un
AA seq 336 aa AA seqDB search
MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQF
CYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLS
IDGQVKRIHQFVECLKLNKKPFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYST
DNQFVQRLKELQDSAAVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHN
NFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVEL
LENCGHSVVMERPRKTAKLIIDFLAFVHNTDNKKLD
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggatcttgatgtggttaacatgtttgtgattgcgggcgggacactggccatcccaatc
ctggcattcgtggcttcatttcttctgtggccttcagcgctgataagaatctactattgg
tactggcggaggacattgggcatgcaagtccgctatgttcaccatgaagactatcagttc
tgttattccttccggggcaggcctgggcacaaaccctccatcctcatgctccacggattc
tctgcccacaaggatatgtggctcagtgtggtcaagttccttccaaagaacctgcacttg
gtctgcgtggacatgccaggacatgagggcaccacccgctcctccctggatgacctgtcc
atagatgggcaagtcaaaaggatacaccagtttgtagaatgcctgaagctgaacaaaaaa
cctttccacctggtaggcacctccatgggtggccaggtggctggggtatatgctgcttac
tacccatcggatgtctccagcctgtgtcttgtgtgtcctgctggcctgcagtactcaact
gacaatcaattcgtacaacggctcaaagaactgcaggactctgccgctgtggagaagatt
cccttgatcccgtctaccccagaagagatgagtgaaatgcttcagctctgctcctatgtc
cgcttcaaggtgccccagcagatcctgcaaggccttgtcgatgtccgcatccctcataac
aacttctaccgaaagctgtttttggaaatcgtcagtgagaagtccagatactccctccat
cagaacatggacaagatcaaggttccgacgcagatcatctgggggaaacaagaccaggtg
ctggatgtgtctggggcagacatgttggccaagtcaattgccaactgccaggtggagctt
ctggaaaactgtgggcactcggtagtgatggagagacccaggaagacagccaagctcata
atcgactttttagcttttgtgcacaacacagacaacaagaagctggactga

DBGET integrated database retrieval system