KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108543956
Entry
108543956         CDS       T04641                                 

Gene name
ASIC1
Definition
(RefSeq) acid sensing ion channel subunit 1
  KO
K04829  acid-sensing ion channel 1
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108543956 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rbb04040]
    108543956 (ASIC1)
Ion channels [BR:rbb04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   108543956 (ASIC1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 108543956
NCBI-ProteinID: XP_017750319
Position
Un
AA seq 563 aa
MPIRIFCSVSFSSGEEAPGPLGDIWGPHHHQQQQDISESEEEEEEKEKEAVRKEASERHS
PIDLVAFANSCTLHGTNHIFVEGGPGPRQVLWAVAFVLALGAFLCQVGDRVAYYLSYPHV
TLLNEVATTELAFPAVTLCNTNAVRLSQLSYPDLLYLAPMLGLDESDDPGVPLAPPGPEA
FSGEPFNLHRFYNRSCHRLEDMLLYCSYQGGPCGPHNFSVVFTRYGKCYTFNSGRDGRPR
LKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVA
PGFQTFVACQEQRQLIYLPPPWGTCKAVTMDSDLDFFDSYSITACRIDCETRYLVENCNC
RMVHMPGDAPYCTPEQYKECADPALDFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKA
SAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQMGLFIGA
SILTVLELFDYAYEVIKHKLCRRGKCQKEAKRSSADKGVALSLDDVKRHNPCESLRGHPA
GMTYAANILPHHPARGTFEDFTC
NT seq 1692 nt   +upstreamnt  +downstreamnt
atgccgatccggatcttctgctctgtgtcattctcctctggagaggaggccccagggccc
ttgggagatatttggggtccccaccaccatcagcagcagcaggacatctcagaatcagaa
gaggaggaagaagagaaggaaaaggaggcagtgaggaaggaggccagcgagaggcattca
cccatagacttggtggcctttgccaacagctgcaccctccacggcaccaaccacattttt
gtggaggggggtccaggaccaaggcaggtgctgtgggcagtggcctttgtcctggcactg
ggtgccttcctgtgccaggtaggggaccgcgttgcttattaccttagctacccacacgtg
accctgctaaacgaagtggccaccacggagctggccttcccggcggtcaccctctgcaac
actaatgccgtgcggctgtcccagctcagctaccctgacttgctttatctggcccccatg
ctgggactggatgaaagtgatgaccctggggtgcccctcgctccaccaggccctgaggcc
ttctctggggagccctttaacctgcaccgcttctacaatcgctcctgccaccggctggag
gacatgctgctctattgctcctaccaaggggggccctgtggccctcacaacttctcagtg
gtcttcacacgctatggaaagtgctacacgttcaactcgggccgagatgggcggccacgg
ctgaagaccatgaagggtgggacaggcaatgggctggaaatcatgctggacatccagcag
gacgagtacctgcctgtgtggggggagactgatgagacgtccttcgaagcaggcatcaaa
gtgcagatccatagtcaggatgaacctcctttcatcgaccagctgggctttggcgtggcc
ccaggcttccagacctttgtggcctgccaggagcagcggcagctcatctacctgccgccg
ccctggggcacctgcaaagctgttaccatggactcggatttggatttcttcgactcctac
agcatcaccgcctgccgcatcgactgtgagacgcgctacctggtggagaactgcaactgc
cgcatggtgcacatgccaggggatgccccatactgtactccagagcagtacaaggagtgt
gcagatcctgctctggacttcctggtggagaaggaccaggagtactgcgtgtgtgaaatg
ccttgcaacctgacccgctatggcaaggagctgtccatggtcaagatccccagcaaagcc
tcagccaagtacctggccaagaagttcaacaaatctgagcaatacataggggagaacatc
ctggtgctggacattttctttgaagtcctcaactatgagaccattgaacagaagaaggcc
tatgagattgcagggctcctgggtgacatcgggggccagatggggctgttcatcggcgcc
agcatcctcacggtgctggagctctttgactacgcctacgaggtcattaagcacaagctg
tgccgacgaggaaagtgccagaaggaggccaaaaggagcagtgcggacaagggcgtggcc
ctcagcctggacgacgtcaaaagacacaacccgtgcgagagcctccggggccaccctgcc
gggatgacatacgctgccaacatcctacctcaccatccggcccgaggcacgttcgaggac
tttacctgctga

DBGET integrated database retrieval system