KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108544335Help
Entry
108544335         CDS       T04641                                 

Gene name
PLA2G4B
Definition
(RefSeq) phospholipase A2 group IVB
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00564  Glycerophospholipid metabolism
rbb00565  Ether lipid metabolism
rbb00590  Arachidonic acid metabolism
rbb00591  Linoleic acid metabolism
rbb00592  alpha-Linolenic acid metabolism
rbb01100  Metabolic pathways
rbb04010  MAPK signaling pathway
rbb04014  Ras signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04217  Necroptosis
rbb04270  Vascular smooth muscle contraction
rbb04370  VEGF signaling pathway
rbb04611  Platelet activation
rbb04664  Fc epsilon RI signaling pathway
rbb04666  Fc gamma R-mediated phagocytosis
rbb04724  Glutamatergic synapse
rbb04726  Serotonergic synapse
rbb04730  Long-term depression
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04912  GnRH signaling pathway
rbb04913  Ovarian steroidogenesis
rbb04921  Oxytocin signaling pathway
rbb05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    108544335 (PLA2G4B)
   00565 Ether lipid metabolism
    108544335 (PLA2G4B)
   00590 Arachidonic acid metabolism
    108544335 (PLA2G4B)
   00591 Linoleic acid metabolism
    108544335 (PLA2G4B)
   00592 alpha-Linolenic acid metabolism
    108544335 (PLA2G4B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    108544335 (PLA2G4B)
   04010 MAPK signaling pathway
    108544335 (PLA2G4B)
   04370 VEGF signaling pathway
    108544335 (PLA2G4B)
   04072 Phospholipase D signaling pathway
    108544335 (PLA2G4B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108544335 (PLA2G4B)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108544335 (PLA2G4B)
   04664 Fc epsilon RI signaling pathway
    108544335 (PLA2G4B)
   04666 Fc gamma R-mediated phagocytosis
    108544335 (PLA2G4B)
  09152 Endocrine system
   04912 GnRH signaling pathway
    108544335 (PLA2G4B)
   04913 Ovarian steroidogenesis
    108544335 (PLA2G4B)
   04921 Oxytocin signaling pathway
    108544335 (PLA2G4B)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108544335 (PLA2G4B)
  09156 Nervous system
   04724 Glutamatergic synapse
    108544335 (PLA2G4B)
   04726 Serotonergic synapse
    108544335 (PLA2G4B)
   04730 Long-term depression
    108544335 (PLA2G4B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108544335 (PLA2G4B)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    108544335 (PLA2G4B)
Enzymes [BR:rbb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     108544335 (PLA2G4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 108544335
NCBI-ProteinID: XP_017750890
Position
Un
AA seq 798 aa AA seqDB search
MALAEVSRTCLLTVHVLRAHRLPSKDLVTPSDCYVTLWLPTACSHRLQTRTVKNSSSPVW
NQSFHFRIHRQLKNVMELKVFDQDLVTGDDPVLSVLFDAGTLRAGELRHESFSLSPQGEG
CLEVEFRLQSLADCGEQLVSNGVLVARELSCLHVQLEETGDQKPSERRVQLVVPGSCEGP
QEASVGTGTFRFHCPACWEQELRIHLQDAPEEQLKVPLSALPSDQVVRLVFPTSQDPLMR
VELKKEAGPRQLAVRLGFRPCAEEQAFLSRRKQVVAAALRQALQLDGDLQEDEIPVVAIM
ATGGGIRAMTSLYGQLAGLQELGLLDCVSYITGASGSTWALANLYEDPEWSQKDLAGPTE
LLKTQVTKSKLGVLAPSQLQRYRQELAERARLGYPSCFTSLWALINEALLHDKPHDHKLS
DQREALSHGQNPLPIYCALNTKGQSLSTFEFGEWCEFSPYEVGFPKYGTFIPSELFGSEF
FMGRLTRKLPESRICFLEGIWSNLYAANLQDSLYWASEPSQFWDRWVRNQANLDKEQVPL
LKIEEPPSTASRIAAFFTDLLTRRPLAQATHNFLRGLHFHKDYFQHPHFSTWKATTLDGL
PNQLTPSEPHLCLLDVGYLINTSCLPLLQPTRDVDLILSLDYNLHGAFQAGFVGPTGDPD
LAFEPQQLQLLGRFCQEQGIPFPPISPSPEEQLQPRECHTFSDPTCPGAPAVLHFPLVSD
SFREYSAPGVRRTPEEAAAGEVNLSSVDSPYHYTKVTYSQEDVDKLLRLTHYNVCNNREQ
LLEALRQAVQRRRQRRPQ
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atggctctggcagaggtgtccaggacctgcctgctcacggttcatgtcctgagggcccat
cgcctaccctctaaggacctagtgaccccctctgactgctacgtgactctctggctgccc
acagcctgcagccacaggctccagacacgcacagtcaagaacagcagtagccctgtgtgg
aaccagagctttcacttcaggatccacaggcagctcaagaatgtcatggaactgaaagtc
tttgaccaggacctggtgaccggagatgaccctgtgttgtcagtgctgtttgatgcgggg
actctgcgggctggggagttgcggcacgagagcttctcactgagccctcagggtgagggg
tgcctggaagttgaatttcgcctgcagagtctggctgactgtggcgagcagctcgtcagc
aatggcgttctggtggcccgggagctctcctgcttgcacgttcaactggaggagacagga
gaccagaagccctcagagcgcagagttcagcttgtggttcctgggtcctgtgagggtccg
caggaggcctctgtgggcactggcaccttccgcttccactgcccagcctgctgggaacag
gagctgaggattcacctacaggatgcccccgaggagcaactaaaggtgccactgagtgcc
ctgccctctgaccaagtggtgaggcttgtcttccccacgtcccaggaccccctgatgaga
gtggagctgaaaaaagaagcaggaccgaggcagctggccgtgcgactgggcttcaggccc
tgtgcagaggaacaggccttcctgagcaggaggaagcaggtggtggccgcggccttgcgg
caggccctgcagctagatggagacctgcaagaggacgagatccctgtggtagctattatg
gccactggcggtgggatccgggcaatgacttccctgtacgggcagctggccggcctgcag
gagctgggcctcttggattgcgtctcctacattaccggggcctcgggctccacctgggcc
ttggccaacctctatgaggacccagagtggtctcagaaggacctggcagggcccactgag
ttgctaaagacccaggtgaccaagagcaagctcggtgtgctggcccccagccagctgcag
cggtaccggcaggagctggctgagcgtgcccgcctgggctacccaagctgcttcaccagc
ctgtgggccctcatcaacgaggcgctgctgcacgacaagccccatgaccacaagctctca
gatcagcgggaggccctgagtcatggccagaaccctctgcccatctactgtgccctcaac
accaaggggcagagcctgtccacttttgagtttggggagtggtgcgagttctctccctac
gaggtcggcttccccaagtatgggaccttcatcccctcggagctgttcggctctgagttc
ttcatggggcggctgacgaggaagctccctgagtcccgcatctgcttcttagaaggtatc
tggagcaacctgtatgcagccaacctccaggacagcttatactgggcctcagagcccagc
cagttctgggaccgctgggtcaggaaccaggccaacctggacaaggaacaggtccccctt
ttgaagatagaagaaccaccctcaacagccagcaggatagctgcgtttttcactgatctt
ctgacacggcgcccactggcccaggccacacataatttcctgcgtggcctccatttccac
aaagactactttcagcatcctcacttctccacctggaaagctaccactctggatgggctc
cccaaccagctgacaccctcggagccccacctgtgcctgctggatgttggctacctcatc
aacaccagctgcctgcccctcctgcagcccactcgggacgtggacctcatcctgtcattg
gactacaacctccacggagccttccaggctggcttcgtaggccccactggagaccctgac
ttggcatttgagccccagcagctgcagctcctgggccggttctgccaggagcaggggatc
ccgttcccgcccatctcgcccagcccggaagagcagctccagcctcgggagtgccacacc
ttctctgaccccacctgccccggagcccctgcggtgctgcacttccctcttgtcagcgac
tccttccgggagtactcggcccctggggtccggcggacacctgaggaggcggcggctggg
gaggtgaacctgtcttcagtggactctccctaccactacacgaaggtgacctacagccag
gaggatgtggacaagctgctgcgcctgacacattacaatgtctgcaacaaccgggagcag
ctgctggaggccctgcgccaggcggtgcagcggaggcggcagcgcaggccccagtga

DBGET integrated database retrieval system