KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108544837Help
Entry
108544837         CDS       T04641                                 

Gene name
SLC27A2
Definition
(RefSeq) solute carrier family 27 member 2
  KO
K08746  solute carrier family 27 (fatty acid transporter), member 2 [EC:6.2.1.- 6.2.1.3]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb03320  PPAR signaling pathway
rbb04146  Peroxisome
rbb04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    108544837 (SLC27A2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    108544837 (SLC27A2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    108544837 (SLC27A2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rbb01004]
    108544837 (SLC27A2)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rbb02000]
    108544837 (SLC27A2)
Enzymes [BR:rbb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     108544837 (SLC27A2)
    6.2.1.-  
     108544837 (SLC27A2)
Lipid biosynthesis proteins [BR:rbb01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   108544837 (SLC27A2)
Transporters [BR:rbb02000]
 Solute Carrier Family (SLC)
  SLC27: Fatty acid transporter
   108544837 (SLC27A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 108544837
NCBI-ProteinID: XP_017751695
UniProt: A0A2K6L8L5
Position
Un
AA seq 620 aa AA seqDB search
MLSAIYTVLAGLVFLPLLVNLCCPYFFQDVGYFLKVAAVGRRARSYGQRRPARTILRAFL
EKARQTPHKPFLLFRDETLTYAQVDQRSNQVARALHDHLGLRQGDCVALFMGNEPAYVWL
WLGLMKLGCAMACLNYNIRAKSLLHCFQCCGAKVLLASPELQTAVEEILPSLKKDDVSIY
YVSRTSNTDGIDSFLDKVDEVSAEPTPESWRSEVTFSAPALYIYTSGTTGLPKAAMITHQ
RIWYGTGLTFVSGLKADDVIYITLPLYHSAALLIGFHGCIVAGATLALRTKFSASQFWDD
CRKYNITVIQYIGELLRYLCNTPQKPNDRDHKVRLALGNGLRGDVWRQFVKRFGDICIYE
FYAATEGNIGFMNYTRKVGAVGRVNYLQKKIISYDLIKYDVEKDEPVRDENGYCIRVPKG
EVGLLVCKITQLTPFSGYAGAKAQTEKKKLRDVFKKGDLYFNSGDLLMVDRENFIYFHDR
IGDTFRWKGENVATTEVADIVGLVDFVQEVNVYGVRVPDHEGRIGMASIKMKENHEFDGK
KLFQHVADYLPSYARPRFLRIQDTIEITGTFKHRKVTLVEEGFNPAVIKDALYFLDDTAK
TYVPMTEDIYNAISAKTLKL
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgctttccgccatctacacagtcctggcggggctggtgttcctgccgctcctggtgaac
ctctgctgcccctacttcttccaggacgtgggctacttcttgaaggtggccgccgtgggc
cggagggcgcgcagctacgggcagcggcggccggctcgcaccatcctgcgggcgttcctg
gagaaagcgcgccagactccacacaagccttttctgctcttccgcgacgagactctcacc
tacgcgcaagtggaccagcgcagcaaccaggtggcccgggcgctgcacgaccacctcggc
ctgcgccagggagactgcgtggcgctctttatgggtaacgagccggcctacgtgtggctg
tggctagggctgatgaagctgggctgtgccatggcgtgcctcaattacaacatccgcgca
aagtccctgctgcactgcttccagtgttgcggggcgaaggtgctgctggcgtcgccagaa
ctacaaacagctgttgaagagatactgccaagccttaaaaaagatgatgtgtccatctat
tatgtgagcagaacttctaacacagatgggattgactctttcctggacaaagtggatgaa
gtatcagctgaacctaccccagagtcatggaggtctgaagtcactttttccgctcctgcc
ttatacatttatacttctggaaccacaggtcttccaaaagcggccatgatcactcatcag
cgcatatggtatggaactggcctcacttttgtaagcggattgaaggcagatgatgtcatc
tatatcactctgcccttgtaccacagtgctgcactattgattggctttcacggatgtatt
gtggcgggtgctactcttgccttgcggactaaattttcagccagccagttttgggatgac
tgcagaaaatacaacatcactgtcattcagtatatcggtgaactgcttcggtatttatgc
aacacaccacagaagccaaatgaccgtgatcataaagtgagactggcactgggcaatggc
ttacgaggagatgtgtggagacaatttgtcaagagatttggagacatatgcatctatgag
ttctatgctgccactgaaggcaatattggatttatgaattatacgagaaaagtcggtgct
gttggaagagtaaattacctacagaaaaaaatcataagttatgacctgattaaatatgat
gtggagaaagatgaacctgtccgtgatgaaaatggttattgcatcagagttcccaaaggt
gaagttggacttctggtttgcaaaatcacacaacttacaccatttagtggctatgctgga
gcaaaggctcagacagagaagaaaaaactgagagatgtctttaagaaaggagacctctat
ttcaacagtggagatctcttaatggttgaccgtgaaaatttcatctatttccacgacaga
attggagatacattccggtggaaaggggaaaatgtggccaccactgaagttgctgatata
gtaggactggttgattttgtccaagaagtgaatgtttatggagtgcgtgtgccagatcat
gagggtcgcattggcatggcctccatcaaaatgaaagaaaaccatgaatttgatggaaag
aaactctttcagcacgttgctgattacctgcctagttacgcgaggccccggtttctaaga
atacaggacaccattgagatcactggaacttttaaacaccgcaaagtgaccctggtggag
gagggctttaaccccgctgtcatcaaagatgccttgtatttcttggacgacacagcaaaa
acgtatgtgcctatgacggaggacatctataatgccataagtgctaaaaccctgaaactc
tga

DBGET integrated database retrieval system