KEGG   Mucinivorans hirudinis: BN938_2810Help
Entry
BN938_2810        CDS       T03205                                 

Definition
(GenBank) 3-oxoacyl-[acyl-carrier protein] reductase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
rbc  Mucinivorans hirudinis
Pathway
rbc00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:rbc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    BN938_2810
Enzymes [BR:rbc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     BN938_2810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase AdoHcyase_NAD Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: CDN32876
UniProt: A0A060RB63
Position
complement(2836117..2836893)
Genome map
AA seq 258 aa AA seqDB search
MSINQLFDLTGKVAIVTGGGDGIGKGSCEILAQAGASVVVSDLTIDKAQAVADELNANGG
KAIAVECNVLKDEDLVRLVDEAVKAFGTVNILINNAGGGGGGRENPFKVDLAYFERIFNF
NVFSAWRLCQLTVPHMAKSGYGSIVNITSMGSINKSPNMSAYASSKAALNHMAANLAYDF
GPMGVRINNVGPGATVTHALKTVLTPEIEAKMLQHTPIKRLGEVPDITGAVLYFAAPVSE
WVSGQVLFVNGGGVQTLD
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgagcattaatcaactatttgacctcaccggcaaagttgctatagtaaccggtggtggc
gatggaatcggaaaagggagctgcgaaatcttggctcaagccggggcaagtgtagtggtt
agcgacctgacaatcgacaaggcacaagccgtagccgatgaactcaatgcaaatggcggt
aaggcaatcgccgttgagtgcaatgtactgaaagatgaagaccttgtaaggcttgttgat
gaggctgtaaaggcgttcggcacagtcaatattcttatcaacaatgccggtggcggcggc
ggtggaagagagaaccccttcaaggtagacctcgcctatttcgagcggatcttcaatttc
aacgtattcagtgcgtggcgtttgtgccagcttacagtgccacatatggctaagtctggc
tatggtagtattgtgaacattacctcgatgggcagtatcaacaaaagtcccaatatgagt
gcttatgcctcctcgaaagccgcgctgaaccatatggcggcaaatctcgcttatgacttc
ggtccgatgggagttcgcatcaacaatgtcggacccggcgcaaccgttacacacgccctc
aaaacagtccttacgcctgaaattgaggcaaagatgttgcaacacacgccaatcaaacgc
cttggcgaagtgcccgatattaccggagcggtgctatattttgcagcccccgtttctgag
tgggtaagcggacaggtgctatttgtgaatggcggtggagtacaaaccttagactaa

DBGET integrated database retrieval system