KEGG   Rhodanobacteraceae bacterium Dysh456: ALSL_0950Help
Entry
ALSL_0950         CDS       T06043                                 

Definition
(GenBank) glutathione peroxidase family protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rbd  Rhodanobacteraceae bacterium Dysh456
Pathway
rbd00480  Glutathione metabolism
rbd00590  Arachidonic acid metabolism
rbd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rbd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    ALSL_0950
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ALSL_0950
Enzymes [BR:rbd01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ALSL_0950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: BBD79614
UniProt: A0A2Z6E4A8
Position
1025443..1025931
Genome map
AA seq 162 aa AA seqDB search
MSAIYDFSALDIDGRERSLGEWRGKTLLIVNVASRCGFTPQYASLEALWRRHRARGLVVL
GFPCDQFGHQEPGDEAEIRAFCTTRYEVSFPLFAKVEVNGPRAHPLFRWLQRERRGLLGS
GAIKWNFTKFLIDDRGRVVARRAPMTRPEVIERDVLACLPSA
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgatctacgacttttccgcactcgacatcgatggccgtgagcgttcgctcggc
gaatggcgtggcaagaccttgctcatcgtcaatgtcgcctcccgctgcggcttcacgccg
caatacgctagcctcgaggcgctgtggcgacgccatcgcgcgcgcgggctggtagtgctc
ggctttccctgcgaccagttcggtcaccaggagccgggcgacgaggccgagatccgcgcg
ttctgcaccacccgctacgaggtcagctttccgctgttcgccaaggtcgaggtgaacggc
ccgcgcgcccatccgctgtttcgctggttgcagcgcgagcgccgcgggctgctgggcagt
ggcgcgatcaagtggaacttcaccaagttcctgatcgacgatcgcggccgtgtggtcgcc
cgccgcgcgccgatgacgcgtcccgaggttatcgagcgcgacgtgctggcctgtctgcca
tcggcttga

DBGET integrated database retrieval system