KEGG   Rhodanobacteraceae bacterium Dysh456: ALSL_1034Help
Entry
ALSL_1034         CDS       T06043                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
rbd  Rhodanobacteraceae bacterium Dysh456
Pathway
rbd00450  Selenocompound metabolism
rbd00970  Aminoacyl-tRNA biosynthesis
rbd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rbd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ALSL_1034
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ALSL_1034
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rbd01007]
    ALSL_1034
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rbd03016]
    ALSL_1034
Enzymes [BR:rbd01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     ALSL_1034
Amino acid related enzymes [BR:rbd01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   ALSL_1034
Transfer RNA biogenesis [BR:rbd03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ALSL_1034
 Prokaryotic type
   Other AARSs
    ALSL_1034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: BBD79697
UniProt: A0A2Z6E404
Position
complement(1103809..1105908)
Genome map
AA seq 699 aa AA seqDB search
MSRRLLITHALPYANGPLHMGHMLGYIQSDIWARAQRMMGNEVVFVSADDAHGTPIMLAA
EKAGTTPEAFIEEIRRSHEADFADFHFSHDQYHTTHSPENRELATLIYTRLRDGGYIAKR
TIQQLYDPQKEMFLPDRYIKGTCPRCEAPDQYGDNCEHCGATYAPTELIEPYSVVSGATP
VLRDSEHYFFELSKFETLLNDWFAGRFTGGQPVAHAGVLAKLREWLEGGLKDWDISRDEP
YFGFPIPDAPGKYFYVWLDAPIGYFASLKAWCRRSGRQIEEFLAPGSEAEMHHFIGKDII
NFHGLFWPATLHGADFRVPTALHVNGFLTVNGAKMSKSRGTFILARTYLDAGLDPEYLRY
YFASMLDDTPVDVDLDLKAFEERVNSHLIGKWVNIASRTAGFLHSHFQGRLADDFATQER
ALWQRLIELYGEVPPLYAQGDFAEVCRRFVQMADITNAHIAARAPWQLTKDAARHDELHQ
VCSFAIAAFRLLSGLLKPILPATVAKAESFLAAPIVDFDDARAALHGHVIAAFEPLLGRI
DPKRIEAMIEASKSSLGTPSATSAGATDKAAKQHRHPTGNSTPAASEAPAIVSIDDFARL
DLRVGRVIACEAVEGSDKLLRFELDAGALGRRQIFSGIRAAYAEPEKLVGRNVVFIANLA
PRKMRFGVSEGMILSAGEGGSDLHLLAVDEGAKPGDPVR
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgacgcctgctgatcacccacgccctgccctatgcgaacggcccgctgcacatg
ggccacatgctgggctacatccagagcgacatctgggcgcgtgcacaacggatgatgggc
aacgaggtggtcttcgtcagcgcggacgacgcccacggcacgccgatcatgctggcggcg
gaaaaggccggcacgacgccggaggccttcatcgaggagatccgccgcagccacgaggcc
gacttcgccgacttccatttcagccacgaccagtaccacaccacccattcgccggaaaac
cgcgaactggccacgctgatctacacgcgtctgcgcgatggcggctacatcgccaagcgc
accatccagcagctgtacgacccgcagaaggaaatgttcctgccggatcgctacatcaag
ggcacttgcccgcgctgcgaagcgcccgaccagtatggcgacaactgcgaacactgcggc
gccacctatgcgccgaccgagctgatcgagccctactcggtggtctcgggcgccacgccg
gtgctgcgcgactcggagcattactttttcgagctgtccaagttcgaaaccctgctgaac
gactggttcgccggacgcttcaccggcggccagccggtagcccatgccggcgtgctggcc
aagctgcgcgagtggctggaaggcggcctcaaggattgggacatctcgcgcgacgagccc
tatttcggctttccgattcccgatgcgcccggcaagtatttctacgtctggctggacgcg
ccgatcggctatttcgccagcttaaaggcctggtgccggcgcagcggacgccagatcgag
gaattcctcgcgcccggcagcgaggccgaaatgcaccatttcatcggcaaggacatcatc
aacttccatggcctgttctggccggcgacgctgcatggcgcggatttccgcgtgcccacc
gcgctgcacgtcaacggcttcctgaccgtcaacggcgccaagatgtccaagtcgcgcggc
accttcatcctggcgcgcacctatctcgatgccgggctcgatccggaatacctgcgctac
tacttcgccagcatgctcgatgacacgccggtcgacgtggacctggacctcaaggccttc
gaggaacgcgtcaattcacatctgatcggcaagtgggtcaacatcgccagccgcaccgcg
ggcttcctgcacagccatttccagggccgcctggccgacgacttcgccacccaagagcgg
gcgctctggcagcgcctgatcgaactctatggcgaagtcccgccgctctacgcgcaaggc
gactttgccgaggtctgccgccgtttcgtgcagatggccgacatcaccaatgcccacatc
gccgcgcgcgcaccctggcaactgaccaaggacgccgcgcggcatgacgagctgcaccag
gtgtgctccttcgccatcgccgccttccgcctgctgtccgggctgctcaagccgatcctg
ccggccacggtggccaaggcggaaagcttcctcgccgcgccgatcgtggatttcgacgat
gcgcgcgcggccttgcacgggcatgtcatcgctgcgttcgagccgctgctcggccgcatc
gatcccaaacgcatcgaggcgatgatcgaggcctccaagagttcgctcggcacgccatcg
gccacgagcgctggcgccacggacaaagccgccaagcaacatcgccatcccacgggcaat
agcacaccagcagcgtccgaggcgcccgccatcgtcagcatcgacgatttcgccaggctc
gacctgcgcgtgggcagggtgatcgcctgcgaggcggtggaaggctcggacaagctgctg
cgcttcgagctggacgccggagcgctgggcaggcggcagatcttctccggcatacgcgcc
gcctacgccgagccagaaaaactcgtcggccgcaacgtggtgttcatcgccaacctggcg
ccgcgcaagatgcgttttggcgtatccgagggcatgatcctctcggccggcgagggcggc
agcgacctgcacctgctggccgtggacgaaggcgccaaaccgggcgatccggtgcgctga

DBGET integrated database retrieval system