KEGG   Rhodanobacteraceae bacterium Dysh456: ALSL_1833Help
Entry
ALSL_1833         CDS       T06043                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rbd  Rhodanobacteraceae bacterium Dysh456
Pathway
rbd00071  Fatty acid degradation
rbd00072  Synthesis and degradation of ketone bodies
rbd00280  Valine, leucine and isoleucine degradation
rbd00310  Lysine degradation
rbd00362  Benzoate degradation
rbd00380  Tryptophan metabolism
rbd00620  Pyruvate metabolism
rbd00630  Glyoxylate and dicarboxylate metabolism
rbd00640  Propanoate metabolism
rbd00650  Butanoate metabolism
rbd00900  Terpenoid backbone biosynthesis
rbd01100  Metabolic pathways
rbd01110  Biosynthesis of secondary metabolites
rbd01120  Microbial metabolism in diverse environments
rbd01130  Biosynthesis of antibiotics
rbd01200  Carbon metabolism
rbd01212  Fatty acid metabolism
rbd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rbd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ALSL_1833
   00630 Glyoxylate and dicarboxylate metabolism
    ALSL_1833
   00640 Propanoate metabolism
    ALSL_1833
   00650 Butanoate metabolism
    ALSL_1833
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ALSL_1833
   00072 Synthesis and degradation of ketone bodies
    ALSL_1833
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ALSL_1833
   00310 Lysine degradation
    ALSL_1833
   00380 Tryptophan metabolism
    ALSL_1833
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ALSL_1833
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ALSL_1833
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ALSL_1833
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbd04147]
    ALSL_1833
Enzymes [BR:rbd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ALSL_1833
Exosome [BR:rbd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ALSL_1833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: BBD80480
UniProt: A0A2Z6E5V0
Position
1964423..1965607
Genome map
AA seq 394 aa AA seqDB search
MSDSSIVIVGAKRTAIGSFLGQFTGVPTPKLGAAAIKAALAQAGVDGSDVSEVIMGCVLP
ANLGQAPARQAALAAGLPPAAGCTTINKVCGSGMKSIMLGHDLIKAGSAKIVVAGGMESM
TNAPHMVQARTGIRYGDGQLVDHMAWDGLTDPYQGKAMGVFGELCADKYHFTREEQDAFA
AESVRRAKAAQAEGAFADEIVPVTVAGRKGEVQVDTDEQPGRVDVAKIPTLKPAFRKENG
TITAASSSSISDGAAAVVLMTTDEAKARGIAPLARIVAHATHSQEPEWFTTAPVGAIRKV
LDKAGWKIEDVDLFEVNEAFAVVAMTPMKELGIPHAKLNVHGGACALGHPIGASGARLVV
TLLNAMRQRNVRRGVASLCIGGGEATALAVERLD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtccgattccagcatcgtcatcgtcggcgccaagcgcaccgcgatcggctccttcctc
ggccagttcaccggcgtgccgacgcccaagctcggcgcggccgcgatcaaggccgcgctc
gcgcaggccggcgtcgacggcagcgacgtcagcgaggtgatcatgggctgcgtgctgccg
gccaacctcggccaggcaccggcgcgccaggccgcgctcgccgccgggctgccgccggcc
gccggctgcaccaccatcaacaaggtctgtggctcgggcatgaagtcgatcatgctgggt
cacgatctcatcaaggccggctcggcgaagatcgtcgtcgccggcggcatggagtcgatg
accaacgcgccgcacatggtgcaggcgcgcaccggcatccgctacggcgacggccagctc
gtcgaccacatggcctgggacggcctgaccgatccgtaccagggcaaggcgatgggcgtg
ttcggcgaactgtgcgccgacaagtaccacttcacccgcgaggaacaggacgccttcgcc
gccgaatccgtgcgccgcgccaaggccgcgcaggcggagggcgccttcgccgacgagatc
gtgccggtcaccgtagccgggcgcaagggcgaggtgcaggtggacaccgacgagcagccc
ggccgcgtcgacgtggccaagatcccgaccctcaagcccgccttccgcaaggagaacggc
accatcaccgcggccagttcgtcgagcatctccgacggcgcggccgccgtggtgctgatg
accaccgacgaggccaaggcgcgcggcatcgcgccgctggcgcgcatcgtcgcgcacgcc
acccactcgcaggaaccggaatggttcaccaccgcgccggtcggtgcgatccgcaaggtg
ctggacaaggccggctggaagatcgaggacgtcgatcttttcgaagtcaacgaggccttc
gcggtggtggcgatgacgccgatgaaggagctcggcattccgcacgccaagctcaacgtg
catggcggcgcctgtgcgctgggccatccgatcggcgccagcggcgcccggctggtggtc
accctgctcaatgccatgcgccagcgcaatgtgcgccgcggcgtggcctcgctgtgtatc
ggcggcggcgaggcgactgcgctcgcggtggaacgcctggattga

DBGET integrated database retrieval system