KEGG   Rickettsia bellii RML369-C: RBE_0139Help
Entry
RBE_0139          CDS       T00339                                 

Gene name
paaJ
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rbe  Rickettsia bellii RML369-C
Pathway
rbe00071  Fatty acid degradation
rbe00072  Synthesis and degradation of ketone bodies
rbe00280  Valine, leucine and isoleucine degradation
rbe00310  Lysine degradation
rbe00362  Benzoate degradation
rbe00380  Tryptophan metabolism
rbe00620  Pyruvate metabolism
rbe00630  Glyoxylate and dicarboxylate metabolism
rbe00640  Propanoate metabolism
rbe00650  Butanoate metabolism
rbe00900  Terpenoid backbone biosynthesis
rbe01100  Metabolic pathways
rbe01110  Biosynthesis of secondary metabolites
rbe01120  Microbial metabolism in diverse environments
rbe01130  Biosynthesis of antibiotics
rbe01200  Carbon metabolism
rbe01212  Fatty acid metabolism
rbe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rbe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RBE_0139 (paaJ)
   00630 Glyoxylate and dicarboxylate metabolism
    RBE_0139 (paaJ)
   00640 Propanoate metabolism
    RBE_0139 (paaJ)
   00650 Butanoate metabolism
    RBE_0139 (paaJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RBE_0139 (paaJ)
   00072 Synthesis and degradation of ketone bodies
    RBE_0139 (paaJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RBE_0139 (paaJ)
   00310 Lysine degradation
    RBE_0139 (paaJ)
   00380 Tryptophan metabolism
    RBE_0139 (paaJ)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RBE_0139 (paaJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RBE_0139 (paaJ)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RBE_0139 (paaJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbe04147]
    RBE_0139 (paaJ)
Enzymes [BR:rbe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RBE_0139 (paaJ)
Exosome [BR:rbe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RBE_0139 (paaJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABE04220
UniProt: Q1RK94
Position
complement(157598..158755)
Genome map
AA seq 385 aa AA seqDB search
MQKERLSVLLWVVLVLLTPAPMIATHLIKDILQNSKIDPALVNEVILGQVITGGSGQNPA
RQTLIHAGIPKEVPGYTINKVCGSGLKTVALAAASIMTGDNDIVIAGGQENMSLGMHGSY
IRAGAKFGDIKMVDLMQYDGLTDVFSGVFMGITAENISKQFNITREQQDEFALSSHQKAA
KAQKAGIFKDEILPVEVTIKKTTSLFDHDETVRPDTSLEILGKLRPAFDKNGTVTAGNAS
SINDGAACLMVVSEEALKKHNLTPLARIVSYASAGVDPSIMGTAPVPASQKALSKAGWSI
NDLDLIEVNEAFASQSIYVNREMKWDMNKVNVNGGAIAIGHPIGASGGRVLVTLIHGLRR
NKAKKGLVTLCIGGGMGMAMCVETI
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagaacggctttcggttcttttatgggtagtcttagtactacttactcccgca
ccaatgattgcgacgcacttaataaaagatattctacagaatagtaaaatcgatccggct
ttagtaaatgaggtgatactcgggcaggtgatcacgggcggtagtggacagaatccggca
agacaaactctaattcatgcaggtattcctaaagaagtgccaggctatacaattaataag
gtttgcggttcaggtcttaaaactgtagcacttgcagcagcctcaattatgaccggtgat
aacgatattgttatagcaggtgggcaggaaaatatgtcactcggtatgcatggcagctat
ataagagcaggagctaaattcggtgatatcaaaatggttgatctaatgcaatatgatgga
ttaactgatgtattctcaggagtatttatgggtattactgctgaaaatatctcaaagcaa
tttaatattactagagagcaacaagatgaatttgccttaagctcacatcaaaaagctgca
aaagcccagaaagccggaatatttaaagatgagattttgccggttgaagtaacaatcaag
aaaactactagcttatttgatcatgatgaaacagttagacctgatactagccttgagatt
ttgggtaaattacgccctgcattcgataaaaatggcactgttactgccggtaatgcttca
tcaattaatgatggtgctgcgtgccttatggtagtgtctgaagaggctctaaaaaagcat
aatctaactcctcttgctcgtattgtttcttacgcttctgccggtgttgatccaagtatt
atggggactgctcccgttcctgcctctcaaaaagctctaagcaaagccggttggagcatt
aacgatctagatcttattgaagtaaatgaggcttttgcctctcaaagtatttatgttaat
cgtgaaatgaaatgggatatgaataaggttaatgtgaatggcggagcaatagcaatcgga
catccgatcggtgctagcggcggacgtgttcttgttactttaatacatggattaagaaga
aataaagctaaaaaaggcttggtaacactatgtatcggtggcggtatgggtatggctatg
tgcgttgaaacgatttaa

DBGET integrated database retrieval system