KEGG   Rickettsia bellii RML369-C: RBE_0897Help
Entry
RBE_0897          CDS       T00339                                 

Gene name
secA
Definition
(GenBank) Preprotein translocase secA subunit
  KO
K03070  preprotein translocase subunit SecA
Organism
rbe  Rickettsia bellii RML369-C
Pathway
rbe02024  Quorum sensing
rbe03060  Protein export
rbe03070  Bacterial secretion system
Module
rbe_M00335  Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:rbe00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    RBE_0897 (secA)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    RBE_0897 (secA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    RBE_0897 (secA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rbe02044]
    RBE_0897 (secA)
Secretion system [BR:rbe02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   RBE_0897 (secA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecA_DEAD SecA_SW SecA_PP_bind SEC-C DEAD Helicase_C ResIII
Motif
Other DBs
NCBI-ProteinID: ABE04978
UniProt: Q1RI36
Position
complement(986950..989682)
Genome map
AA seq 910 aa AA seqDB search
MFSILKKIFGTANDRTIKKLFSDIAKINSLEPAIQKLSDEELKNKTVEFKKKLKNGATLD
DIAYEAFAVVREASRRVYGMRHFDVQLIGGLVLHRGMITEMRTGEGKTLVATLPAYLNAL
AEKGVHVVTVNDYLVSRDSASMGKIYNFLGLSVGCIVAGMTDEAKREAYNSDITYATNNE
LGFDYLRDNMKYSLQERVLRPFNFAIIDEVDSILIDEARTPLVISGPVNDNSELYGKVDK
LVRMLNVSDFEKDEKLKTINLTESGISHVESLLSQADIIKPNSGLYDFENLSLVHYVNQA
LRAHNMFMIDVDYLVRDGKVMIIDEFTGRVMEGRRYSEGLHQALEAKENVKIQNENQTLA
SITFQNYFRNYPKLSGMTGTAMTEAPELKDIYNLDVVAVPTHNKVTRRDLDDEIYGSKKE
KYDAILKLIKDCYDRGQPVLVGTVSIEKSEEISNVLNKNKIPHKVLNAKFHEQEAFIIAQ
AGRFKAVTIATNMAGRGTDIMLGGNPEMLIEQIDRKSLTNAAYKEKVNEIKAQTAEEKKQ
VIAAGGLFVIGTERHESRRIDNQLRGRSGRQGDPGNTKFFLSLDDDLMRIFASERISGVL
RTLGLKDGEAIHHPMISRSLEKAQQKVEGHNYEIRKNLLRFDDVMNDQRKIIYEQRTEII
KSKDSYDFLSSTTEELAKKIVLTFMPAGSYREDWDIENLSVELHRTFAIKLDQNLISKND
VTEEEVTKIVIQTADSIYKSKEEAYSPDLMHNAVKYILLTTLDQVWKDHLHSLDHLRQGI
SLRAYAQKDPLSEYKREAFNLFEHMLNNLKELFIQTVYHFHIDLKHIQKEDISLENKKLQ
NNMHESREDPAFSKYNAGSNLETDLRPVISRINPEDRDPKNPTSWGKVSRNELCPCGSGK
KYKYCHGLNE
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atgttttctatattgaaaaaaatttttggtacggcaaatgatcgtacgataaaaaaacta
ttttctgacattgcaaaaattaattcgcttgaacctgcgattcaaaaattatcagatgaa
gaattaaaaaataagactgtagaatttaagaaaaaacttaaaaatggtgctactttagat
gatatagcatatgaagcatttgcggtagttagagaggcttcgagaagagtatatggaatg
cgtcattttgatgtgcagcttataggtggtttggtattacacagaggaatgattaccgag
atgcgtacaggggagggcaaaaccttagttgcaacacttcctgcatatttaaatgcttta
gctgagaaaggtgtacatgtcgtaacagttaatgattatcttgttagccgtgattccgct
tccatgggcaagatttataattttttaggtttatcagttggatgtattgttgctggcatg
acagatgaagctaagcgagaagcctataattctgatattacatatgccacaaataacgag
cttggctttgattacttaagagataatatgaaatatagcttgcaggagcgagtacttcgt
ccttttaactttgctattatcgatgaagtagattcgattttaatagatgaagcaagaact
cctttggttatttctggtccagttaatgataattcagaattatatggtaaagtcgataag
cttgtacgcatgcttaatgtaagtgattttgaaaaagatgaaaaattaaaaactatcaat
ttaacggaaagcggcattagtcatgtagaatcgcttttaagtcaagcggatattataaag
cccaattctggtttatatgattttgaaaatttaagcctagtacattacgttaatcaagcc
ctcagagcccacaacatgtttatgatcgatgtagattatttagtacgtgatggtaaagta
atgatcatagatgagtttacaggacgggtaatggaagggcgtagatattctgaagggcta
catcaagcgttagaagcaaaagaaaacgtaaaaatccaaaacgaaaaccaaacgcttgca
tctattaccttccaaaattattttcgtaattaccctaaattatcaggcatgactggtaca
gctatgaccgaagcaccagagctaaaagatatatataatcttgatgtagtagcagtaccg
actcataataaagttacaagacgtgatcttgatgacgaaatttatggaagcaaaaaagaa
aaatatgatgctattttaaagctaattaaagattgttatgatcgtggtcagccggtgctt
gtcggtactgtaagtatagaaaagtcagaagaaatttctaatgttctaaataaaaacaaa
ataccgcataaagtattaaatgctaaattccatgagcaagaagcatttattatcgctcaa
gcaggtagatttaaagcagtaacgattgcaactaatatggcagggcgaggtactgatatt
atgcttggcggtaatcctgaaatgctgatagagcagatagatagaaaatctttaactaat
gctgcttataaagaaaaagtaaatgagataaaagctcaaacagctgaagagaaaaagcaa
gtaattgcagcaggcgggttatttgtaataggtacagaacgtcatgaaagccgtagaata
gataatcaactacgtggtagatcaggtaggcaaggtgacccaggtaatactaaatttttc
ttatcgcttgatgatgatttaatgcgtatttttgcctcagaacgtatttcaggagtgctt
cggacgcttggcttaaaagatggcgaggcaatacatcatccaatgattagtcgatcactc
gagaaagctcagcaaaaagtcgaggggcataactatgaaatacgtaaaaatttattacgt
tttgatgatgtgatgaatgatcagcgtaaaataatatatgagcaaagaactgaaattatt
aaatctaaagatagttatgacttcttaagtagtactactgaggaattagctaaaaaaata
gtgctaacttttatgccagcgggctcttatagagaagattgggatatagagaatttaagc
gtagaactacaccgcacttttgctataaagcttgatcaaaatctgataagcaaaaatgat
gtaacagaagaagaagttacaaaaattgttattcaaacagcggatagtatatataaatct
aaggaagaagcatatagtcctgacttaatgcataatgctgtaaaatatattttattaact
actcttgatcaggtttggaaagatcacttgcatagcttggatcacttaagacaaggtata
tctcttagagcttatgcccaaaaagatcctttaagtgaatataaaagagaggcatttaat
ttatttgagcatatgcttaataatttaaaagaactctttattcaaacagtctaccacttc
catattgacttaaagcatattcaaaaagaagatatatctcttgaaaataaaaagctgcaa
aataatatgcatgaaagccgtgaagatccggcatttagtaagtataatgcaggtagtaac
ttagaaactgatcttagacctgtcatatcacgcattaacccagaggatagagatcctaaa
aatcctacaagctggggcaaggtatctagaaatgagctatgcccttgtggttcaggtaag
aaatataaatattgccacggactaaacgagtag

DBGET integrated database retrieval system