KEGG   Rickettsia bellii RML369-C: RBE_1098Help
Entry
RBE_1098          CDS       T00339                                 

Gene name
sucB
Definition
(GenBank) Dihydrolipoamide acetyltransferase component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rbe  Rickettsia bellii RML369-C
Pathway
rbe00020  Citrate cycle (TCA cycle)
rbe00310  Lysine degradation
rbe01100  Metabolic pathways
rbe01110  Biosynthesis of secondary metabolites
rbe01120  Microbial metabolism in diverse environments
rbe01130  Biosynthesis of antibiotics
rbe01200  Carbon metabolism
Module
rbe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rbe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rbe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RBE_1098 (sucB)
  09105 Amino acid metabolism
   00310 Lysine degradation
    RBE_1098 (sucB)
Enzymes [BR:rbe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RBE_1098 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ABE05179
UniProt: Q1RHI5
Position
complement(1184412..1185614)
Genome map
AA seq 400 aa AA seqDB search
MGVKIIVPSLGESVTEATIAKWYKKEGDAVKTDELLLEIETEKVTLEVNSPCNGTIGKII
KADGANVAVGEEIGDINEGEAVATNSNEAAKPQTASQPVPEKVPKKPAVANNTLAPSVQK
LVTENKLDPNNIKGTGKDGRITKGDVLETMNAPTPAATSTTSSAKASEERVERVRMSRLR
KTIAQRLKDSQNTAAILTTFNEIDMSKVIALRGKYKDEFEKKHGVKLGFMSFFVRATIEA
LKLIPSVNAEIDGDDLVYKNYYDIGVAVGTEQGLVVPVVRDADKMGFADIEKTIGGLAKK
ARDGKLSMADLSGGTFSISNGGVYGSLLSTPIINPPQSGILGLHKTEERVVAIDGKIEIR
PMMYIALSYDHRIIDGKEAVSFLVKIKELIESPEKLLLNL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgggtgttaaaattatagtgccgtctctcggtgaatcggtaacagaagcgactattgcc
aagtggtataagaaagagggcgatgctgttaaaaccgatgaattattattggaaattgaa
actgagaaagtaacattagaagttaattccccgtgcaatggtactataggtaaaataata
aaagctgacggagcaaatgttgcagttggtgaagaaataggcgatataaatgagggggaa
gctgtagcaacaaatagtaacgaagcagcaaaacctcaaacagcttcccagcctgttcca
gaaaaagtaccaaaaaagccagcagttgctaataatacccttgctccatctgtgcagaaa
ttagttactgaaaataagcttgatccaaataatataaaaggaacaggcaaagatggtaga
attaccaaaggtgatgtattagagactatgaacgctcctactcctgccgctacttctacc
acttcttcagctaaagctagtgaggaaagagtagagcgtgtgcgtatgtcacgtttgcgt
aaaaccattgcacagcgtttaaaagactcacaaaatacagctgctattttgactactttt
aacgaaattgatatgtcaaaagttatagctctgcgtggtaagtataaagatgagtttgag
aaaaagcacggcgtaaagcttggttttatgtcattctttgttagagcaactatcgaagcg
ttaaagcttattccgtcagtaaatgctgagatagatggtgatgatttagtatataaaaat
tattacgatataggtgtagcagttggaacagaacaaggtcttgtcgtgccggttgttaga
gatgctgacaaaatgggatttgctgatattgaaaagacaataggggggctagctaaaaaa
gcaagagatggtaagctttctatggctgatttatcaggtggcacattctcgatttctaat
ggcggtgtatatggttcgcttttatctactcctattattaatccgcctcaatctggtatt
ttaggactacataaaactgaggaaagagtagtggctatagatggtaaaattgaaatacgt
ccgatgatgtatatagctctatcatacgatcaccgcataattgatggaaaggaagctgtt
tcattcttagtaaaaattaaggagctaatagaaagtcctgaaaagctactgctaaactta
tag

DBGET integrated database retrieval system